[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01255
DDBJ      :             
Swiss-Prot:AG19_COCIM   RecName: Full=Heat-stable 19 kDa antigen;AltName: Full=CS-AG;Flags: Precursor;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  52/199 : Viruses  0/175   --->[See Alignment]
b.52.1
:146 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   80->139 2bh0A PDBj 2e-05 12.5 %
:RPS:SCOP  58->139 1n10A2  b.52.1.3 * 8e-07 14.6 %
:HMM:SCOP  11->145 1n10A2 b.52.1.3 * 1.1e-13 21.9 %
:RPS:PFM   29->143 PF07249 * Cerato-platanin 9e-33 55.7 %
:HMM:PFM   29->145 PF07249 * Cerato-platanin 9.9e-52 59.0 117/119  
:BLT:SWISS 1->146 AG19_COCIM 7e-84 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01257 GT:GENE CIRG_01255 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 146 SQ:AASEQ MKFSLLSAIAAAVFVPFTSATPLASTTDLSYDTHYDDPSLALSGVTCSDGDNGMITKGYNTAGEIPNYPHVGGAFTVETWNSPNCGKCYKVTYNAKTIFLTAIDHSNSGFNIAKKSMDVLTNGRAEELGRIKVTYEEVASSLCGLK SW:ID AG19_COCIM SW:DE RecName: Full=Heat-stable 19 kDa antigen;AltName: Full=CS-AG;Flags: Precursor; SW:GN Name=CSA; ORFNames=CIMG_01181; SW:KW Complete proteome; Glycoprotein; Secreted; Signal. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->146|AG19_COCIM|7e-84|100.0|146/146| GO:SWS:NREP 1 GO:SWS GO:0005576|"GO:extracellular region"|Secreted| TM:NTM 1 TM:REGION 1->23| RP:PDB:NREP 1 RP:PDB:REP 80->139|2bh0A|2e-05|12.5|56/200| RP:PFM:NREP 1 RP:PFM:REP 29->143|PF07249|9e-33|55.7|115/118|Cerato-platanin| HM:PFM:NREP 1 HM:PFM:REP 29->145|PF07249|9.9e-52|59.0|117/119|Cerato-platanin| RP:SCP:NREP 1 RP:SCP:REP 58->139|1n10A2|8e-07|14.6|82/133|b.52.1.3| HM:SCP:REP 11->145|1n10A2|1.1e-13|21.9|128/0|b.52.1.3|1/1|Barwin-like endoglucanases| OP:NHOMO 88 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1111112111111111111111111111---2123232322111111---------------------------1G31351---------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 56 STR:RPRED 38.4 SQ:SECSTR ###############################################################################cTTTTTTcEEEEEETTEEEEEEEEEccTTcEEEcHHHHHHHcc####GGccEEEEEEEEc####### DISOP:02AL 146-147| PSIPRED cccHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccEEEEccccccEEEcccccccccccccccccccccccccccccccEEEEEEcccEEEEEEEEccccccEEcHHHHHHHHcccccccccEEEEEEEccHHHcccc //