[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01263
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  197/199 : Viruses  1/175   --->[See Alignment]
d.20.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->150 2onuA PDBj 1e-52 61.5 %
:RPS:PDB   1->149 2aakA PDBj 7e-30 32.9 %
:RPS:SCOP  2->150 1yh6A1  d.20.1.1 * 3e-33 61.9 %
:HMM:SCOP  1->154 1yh6A1 d.20.1.1 * 2.1e-44 36.8 %
:RPS:PFM   27->141 PF00179 * UQ_con 4e-18 37.2 %
:HMM:PFM   19->143 PF00179 * UQ_con 3.8e-39 39.0 123/140  
:BLT:SWISS 1->150 UBC8_SCHPO 3e-72 82.6 %
:PROS 74->90|PS00183|UBIQUITIN_CONJUGAT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01265 GT:GENE CIRG_01263 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 186 SQ:AASEQ MSSPKRRIETDVCPALMSDYEVTLVNDNSKQEFYVRFKGPEETPFAGGLWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVINQTWSPMYDMINIFEVFLPQLLRYPNPSDPLNGDAAAVLLRDPSKYEAKVREYVAKYASKDAADDAGEDTGEEDEMSSVGSYESGGEEPAGEMDDV BL:SWS:NREP 1 BL:SWS:REP 1->150|UBC8_SCHPO|3e-72|82.6|149/184| PROS 74->90|PS00183|UBIQUITIN_CONJUGAT_1|PDOC00163| SEG 151->178|daaddagedtgeedemssvgsyesggee| BL:PDB:NREP 1 BL:PDB:REP 7->150|2onuA|1e-52|61.5|143/150| RP:PDB:NREP 1 RP:PDB:REP 1->149|2aakA|7e-30|32.9|146/150| RP:PFM:NREP 1 RP:PFM:REP 27->141|PF00179|4e-18|37.2|113/137|UQ_con| HM:PFM:NREP 1 HM:PFM:REP 19->143|PF00179|3.8e-39|39.0|123/140|UQ_con| GO:PFM:NREP 3 GO:PFM GO:0019787|"GO:small conjugating protein ligase activity"|PF00179|IPR000608| GO:PFM GO:0043687|"GO:post-translational protein modification"|PF00179|IPR000608| GO:PFM GO:0051246|"GO:regulation of protein metabolic process"|PF00179|IPR000608| RP:SCP:NREP 1 RP:SCP:REP 2->150|1yh6A1|3e-33|61.9|147/152|d.20.1.1| HM:SCP:REP 1->154|1yh6A1|2.1e-44|36.8|152/0|d.20.1.1|1/1|UBC-like| OP:NHOMO 3175 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 8558HHE7R885CFDBFDC9DDCCEDBCCBBBACBC9DDDCDD999BCABBBCCABB9A999B898896897899BB49AB99988BA-CEAFACAA8ABB99FCE6FIFRWhRRUKGCGFEPDZYDVD**i-ZRaEGFHNBITIBFC9DK8FRIMJHLKIMKKNF8REJHDCHGBEC9*BBBFESPcnBaJABACCF9 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---- STR:NPRED 150 STR:RPRED 80.6 SQ:SECSTR cccHHHHHHHHHHHcccTTEEEEEETTEEEEEEEEEEEccTTcTTTTcEEEEEEEccTTTTTcccEEEEccccccTTccTTTcccccGGGTTcccTTccHHHHHHHHHHHHHTcccTTccccHHHHHHHHHcHHHHHHHHHHHHHHHccc#################################### DISOP:02AL 186-187| PSIPRED cccHHHHHHHHHHHccccccEEEEcccccEEEEEEEEEcccccccccEEEEEEEEEcccccccccEEEEEcccccccccccccEEEEHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcccccccccccccccccccccc //