[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01266
DDBJ      :             
Swiss-Prot:ATG12_COCIM  RecName: Full=Autophagy-related protein 12;AltName: Full=Autophagy-related ubiquitin-like modifier ATG12;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  139/199 : Viruses  0/175   --->[See Alignment]
d.15.1
:182 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   96->181 1wz3A PDBj 4e-15 45.8 %
:RPS:PDB   80->182 3d32B PDBj 3e-21 21.6 %
:RPS:SCOP  96->181 1wz3A1  d.15.1.7 * 5e-26 45.8 %
:HMM:SCOP  95->181 1wz3A1 d.15.1.7 * 5.9e-27 45.2 %
:RPS:PFM   96->182 PF04110 * APG12 5e-31 67.8 %
:HMM:PFM   96->182 PF04110 * APG12 1.7e-32 41.4 87/87  
:BLT:SWISS 23->182 ATG12_COCIM 2e-90 100.0 %
:PROS 174->181|PS00501|SPASE_I_1
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01268 GT:GENE CIRG_01266 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 182 SQ:AASEQ MSATPPIPSPGSSKPSSPRSASRNLGLNTRQASRPQIGARRDTNNGSESPAATAPIPDEDHGAELPLTMTASVILTGLPKDAHRALADVEAIDAGKVTVRFHPLPSAPILRNRVFKISASQKFETVVRFLRKKLDCSESDSVFCYVNSVFAPGLDESVGGLWRCFKTDDQLIVSYSMTPAFG SW:ID ATG12_COCIM SW:DE RecName: Full=Autophagy-related protein 12;AltName: Full=Autophagy-related ubiquitin-like modifier ATG12; SW:GN Name=ATG12; ORFNames=CIMG_01191; SW:KW Autophagy; Complete proteome; Cytoplasm; Isopeptide bond;Protein transport; Transport; Ubl conjugation pathway. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 23->182|ATG12_COCIM|2e-90|100.0|160/182| GO:SWS:NREP 4 GO:SWS GO:0006914|"GO:autophagy"|Autophagy| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0015031|"GO:protein transport"|Protein transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 174->181|PS00501|SPASE_I_1|PDOC00418| SEG 5->22|ppipspgsskpssprsas| BL:PDB:NREP 1 BL:PDB:REP 96->181|1wz3A|4e-15|45.8|83/84| RP:PDB:NREP 1 RP:PDB:REP 80->182|3d32B|3e-21|21.6|102/116| RP:PFM:NREP 1 RP:PFM:REP 96->182|PF04110|5e-31|67.8|87/87|APG12| HM:PFM:NREP 1 HM:PFM:REP 96->182|PF04110|1.7e-32|41.4|87/87|APG12| GO:PFM:NREP 2 GO:PFM GO:0000045|"GO:autophagic vacuole assembly"|PF04110|IPR007242| GO:PFM GO:0005737|"GO:cytoplasm"|PF04110|IPR007242| RP:SCP:NREP 1 RP:SCP:REP 96->181|1wz3A1|5e-26|45.8|83/84|d.15.1.7| HM:SCP:REP 95->181|1wz3A1|5.9e-27|45.2|84/0|d.15.1.7|1/1|Ubiquitin-like| OP:NHOMO 149 OP:NHOMOORG 139 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----11------11111111111111-111111111111111111111-111-111111111111111111111111111111111-1-1111111-1-111111--1-121---1--11-11-11-2-131-111--1-1--11--1--1-1111--11--1-111-21--111-1-14---111--1121-1-1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 56.6 SQ:SECSTR ###############################################################################ccHHHHHHHHHHHTEEEEEEEEcTTcccccccccEEEEETTccHHHHHHHHHHHTTccTTcccEEEcTTcccccTTccHHHHHHHHccTccEEEEEEcccccc PSIPRED ccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEccccccHHHHHHHHHcccccccEEEEEccccccccccccEEEEcccccHHHHHHHHHHHHcccHHcEEEEEEcccccccccHHHHHHHHHHccccEEEEEEEcccccc //