[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01281
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  475/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
d.26.1
:131 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->123 2ke0A PDBj 2e-22 45.5 %
:RPS:PDB   19->122 3chxA PDBj 3e-26 13.5 %
:RPS:SCOP  28->123 1q6hA  d.26.1.1 * 2e-26 35.8 %
:HMM:SCOP  21->127 1jvwA_ d.26.1.1 * 2.8e-31 43.4 %
:RPS:PFM   38->121 PF00254 * FKBP_C 3e-19 54.8 %
:HMM:PFM   30->121 PF00254 * FKBP_C 1.7e-32 46.7 92/96  
:BLT:SWISS 20->129 FKBP2_ASPFU 3e-33 60.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01283 GT:GENE CIRG_01281 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 131 SQ:AASEQ MRLLSLFTIITAVAALECADLVIELTHRETCSRPTQAGDTIKIHYRGTFTNGTEFDSSIGQEPLEFPLGANKVIRGFDEGARNMCVGDKRKITIPPLLGYGDKQKGPIPPSSTLIFETELVEIVGVPNEGN BL:SWS:NREP 1 BL:SWS:REP 20->129|FKBP2_ASPFU|3e-33|60.0|110/134| TM:NTM 1 TM:REGION 4->26| BL:PDB:NREP 1 BL:PDB:REP 8->123|2ke0A|2e-22|45.5|110/117| RP:PDB:NREP 1 RP:PDB:REP 19->122|3chxA|3e-26|13.5|104/362| RP:PFM:NREP 1 RP:PFM:REP 38->121|PF00254|3e-19|54.8|84/91|FKBP_C| HM:PFM:NREP 1 HM:PFM:REP 30->121|PF00254|1.7e-32|46.7|92/96|FKBP_C| GO:PFM:NREP 1 GO:PFM GO:0006457|"GO:protein folding"|PF00254|IPR001179| RP:SCP:NREP 1 RP:SCP:REP 28->123|1q6hA|2e-26|35.8|95/210|d.26.1.1| HM:SCP:REP 21->127|1jvwA_|2.8e-31|43.4|106/160|d.26.1.1|1/1|FKBP-like| OP:NHOMO 2149 OP:NHOMOORG 679 OP:PATTERN -------------------------------------111-1-1-12112221--------------- -12-1------1111------1--1------11---111111--111111--111111111111---113-1---1111112------333313331--11233335311111111111111111111111111-111111---2-2221221111111111111111111111111111111111----2-----------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------2-12221------111111-11111------------111111111-1----1-----------21-------111-----------1--1--------------------------------1111-----1111112----11221111-11122222-12221222222212-111112132--111111111122-2132111-1111-62333235-222233-1---------------------------332212313335455444555554554565--11--1-1----22222222222222222-2222222222222222222222222222222222222222222211221212-222222212222--12----1----111-221222211111222233333231113333333323333333323---------2333333333333332222222222----111-221111---1-11111--------------------------11-11-----141 ----674-63355544444444443421243332223333333323232233332333334332323313442334423432232133-35343543133333444-6T77FPDDHA56579C8GD5F6Y*D-FBJ4A67I5BDD79858B34C8DACC76B68974648768864878*54347A99D4A79A6987F ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 92.4 SQ:SECSTR #######ccEEcccccEEcccccccccccEEEcccccEEEEccccccccccTTccccccTTcTTccccccccccTTccccccEEEEccHHHHTTcGGGGcccccccEEEEcccccccEEEEcEEcccc### DISOP:02AL 131-132| PSIPRED cEEEEEEEEEEEccccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEcccccccEEEEEccccccHHHHHHHHHcccccEEEEEEcHHHcccccccccccccccEEEEEEEEEEcccccccc //