[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01285
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  160/199 : Viruses  0/175   --->[See Alignment]
:281 amino acids
:PSIPRED
:RPS:PFM   35->249 PF05875 * aPHC 8e-34 39.2 %
:HMM:PFM   15->257 PF05875 * aPHC 1.3e-83 40.3 243/262  
:BLT:SWISS 1->278 YPC1_YEAST 2e-42 34.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01287 GT:GENE CIRG_01285 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 281 SQ:AASEQ MAIFGWTYPSPPPAGFWSPRTSTMNFCELDYIVTPYIAEFVNTMSNLAYLYLAWRGLFCSERRAGDYAILLSYLQLAGVGVGSIAFHSTLKFPAQIVDEMAMLYATATVIYAVFAFRLRPLVQLMLGLSFFTGSLVITILHIQQENSLAHRVCFALMVIVVAARCTWLLRGVGNAAIRSEMKRLALVGSVTFLAGFLLWLVDVFSCDDLRGIRQILGMPLGMLLELHSWWHILTAFGVYYYLIFVEYIRLQSGVMDRGAVVRLSRDYFLIPRLVALPEKQE BL:SWS:NREP 1 BL:SWS:REP 1->278|YPC1_YEAST|2e-42|34.4|270/316| TM:NTM 7 TM:REGION 39->61| TM:REGION 64->86| TM:REGION 96->117| TM:REGION 123->145| TM:REGION 147->169| TM:REGION 184->206| TM:REGION 234->256| RP:PFM:NREP 1 RP:PFM:REP 35->249|PF05875|8e-34|39.2|204/221|aPHC| HM:PFM:NREP 1 HM:PFM:REP 15->257|PF05875|1.3e-83|40.3|243/262|aPHC| GO:PFM:NREP 3 GO:PFM GO:0006672|"GO:ceramide metabolic process"|PF05875|IPR008901| GO:PFM GO:0016021|"GO:integral to membrane"|PF05875|IPR008901| GO:PFM GO:0016811|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides"|PF05875|IPR008901| OP:NHOMO 292 OP:NHOMOORG 160 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----221------1223222232232311111111133333331112323322311122111111111112211122222111111---12131111111-3-212-1513322321121124143-212A2-2231-122123212211221313123322-1----11---11----1-----4124211--2221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEEcccccc //