[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01619
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  545/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
c.142.1
:169 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   9->168 3i9v1 PDBj 8e-49 53.1 %
:RPS:SCOP  9->168 2fug12  c.142.1.1 * 3e-65 53.1 %
:HMM:SCOP  6->168 2fug12 c.142.1.1 * 3.5e-61 56.4 %
:RPS:PFM   13->154 PF01512 * Complex1_51K 1e-46 65.7 %
:HMM:PFM   7->152 PF01512 * Complex1_51K 2.2e-41 44.1 127/151  
:BLT:SWISS 1->168 NDUV1_ASPNG 6e-93 91.1 %
:PROS 102->117|PS00644|COMPLEX1_51K_1

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01621 GT:GENE CIRG_01619 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 169 SQ:AASEQ MNFKDWDKDPRPRYLVVNADEGEPGTCKDREIMRKDPHKLVEGCLVAGRAMNATAAYIYIRGEFYHEATILQRAINEAYEAGLIGKNACGSGYDFDIYIHRGMGAYICGEETSLIESIEGKAGKPRLKPPFPAAVGLFGCPSTVTNVETVAVAPTICRRGGKWFASFGP BL:SWS:NREP 1 BL:SWS:REP 1->168|NDUV1_ASPNG|6e-93|91.1|168/496| PROS 102->117|PS00644|COMPLEX1_51K_1|PDOC00555| BL:PDB:NREP 1 BL:PDB:REP 9->168|3i9v1|8e-49|53.1|160/437| RP:PFM:NREP 1 RP:PFM:REP 13->154|PF01512|1e-46|65.7|134/162|Complex1_51K| HM:PFM:NREP 1 HM:PFM:REP 7->152|PF01512|2.2e-41|44.1|127/151|Complex1_51K| GO:PFM:NREP 4 GO:PFM GO:0010181|"GO:FMN binding"|PF01512|IPR011538| GO:PFM GO:0016651|"GO:oxidoreductase activity, acting on NADH or NADPH"|PF01512|IPR011538| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01512|IPR011538| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01512|IPR011538| RP:SCP:NREP 1 RP:SCP:REP 9->168|2fug12|3e-65|53.1|160/243|c.142.1.1| HM:SCP:REP 6->168|2fug12|3.5e-61|56.4|163/0|c.142.1.1|1/1|Nqo1 FMN-binding domain-like| OP:NHOMO 1064 OP:NHOMOORG 720 OP:PATTERN -----------------------------1----1---------1--1----------1-1------- 11222---------11211-12--13111111311111111111-1--1-----1-----11211122211----------1-11112--1--1-----1-11--21111--------------1-----1---1-22222333111111111--11------11--11--------------11111331--------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2112--23113436331211121--3--111111111233221133333311111111111-33333433221122223332223333112222333322311111111322-23111111111111111111111111111111121221-22112222222222222222222222223344312331331222223323321222121111111113232131-2-1--3-----343243275111111641--1---------------------11112---2---1-------------1----21--221111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111114-121---------------11111111111-1111221122222-1111111111111--------------111111111111111111111111------------------------------------3223333333221 ----111-211-11111111111111111121111111121111111111111111111111111----1--111------1111111-12111111111111112-1-1115221-111-11111111281-111--1111111-111-11-11-11111111111411311111111H1112131331111131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 160 STR:RPRED 94.7 SQ:SECSTR ########cccccEEEEEcccccTTcccHHHHHHHcHHHHHHHHHHHHHHHTccEEEEEEcTTcHHHHHHHHHHHHHHHHTTcccTTGGGcccccEEEEEEccccGGGGcHHHHHHHHTTcccccccccccTTTccGGGccEEEEEHHHHHTHHHHHHccHHHHHTcc# PSIPRED ccccccccccccEEEEEEccccccccccHHHHHHccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEcccccccccHHHHHHHHHccccccccccccHHHccccccccEEcHHHHHHHHHHHHHHHHHHHHHccc //