[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01621
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  545/915 : Eukaryota  171/199 : Viruses  0/175   --->[See Alignment]
c.142.1d.15.13
:393 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   84->372 3i9v1 PDBj 3e-74 51.8 %
:RPS:SCOP  80->319 2fug12  c.142.1.1 * 2e-95 48.7 %
:RPS:SCOP  321->373 2fug13  d.15.13.1 * 9e-12 50.0 %
:HMM:SCOP  75->320 2fug12 c.142.1.1 * 1.7e-84 48.8 %
:HMM:SCOP  321->376 2fug13 d.15.13.1 * 1.3e-13 45.3 %
:RPS:PFM   124->299 PF01512 * Complex1_51K 8e-58 68.3 %
:HMM:PFM   124->297 PF01512 * Complex1_51K 7.2e-50 46.6 148/151  
:HMM:PFM   323->373 PF10531 * SLBB 3e-11 27.5 51/59  
:HMM:PFM   23->72 PF04695 * Pex14_N 0.00013 24.0 50/136  
:BLT:SWISS 72->376 NDUV1_NEUCR e-168 89.2 %
:PROS 247->262|PS00644|COMPLEX1_51K_1
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01623 GT:GENE CIRG_01621 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 393 SQ:AASEQ MISRAVVAPTTHSISHLSSRALSSASAAAATSTARFPSSQKQSAQQQKQPQQLQTQQQRQYATVQDPAAVPPPRVHGGLKDQDRIFQNLYGRHGPDLKNAMKCGDWYKTKEILLKGHDWIISEIKASGLRGRGGAGFPSGLKWSFMNFKDWDKDPRPRYLVVNADEGEPGTCKDREIMRKDPHKLVEGCLVAGRAMNATAAYIYIRGEFYHEATILQRAINEAYEAGLIGKNACGSGYDFDIYIHRGMGAYICGEETSLIESIEGKAGKPRLKPPFPAAVGLFGCPSTVTNVETVAVAPTICRRGGKWFASFGRERNQGTKLYCISGHVNNPCTVEEEMSIPLRELIDRHCGGVRGGWDNLLAVIPGGSSTPITTKLAQRRSYAWNVGTNKGS BL:SWS:NREP 1 BL:SWS:REP 72->376|NDUV1_NEUCR|e-168|89.2|305/493| PROS 247->262|PS00644|COMPLEX1_51K_1|PDOC00555| SEG 12->65|hsishlssralssasaaaatstarfpssqkqsaqqqkqpqqlqtqqqrqyatvq| BL:PDB:NREP 1 BL:PDB:REP 84->372|3i9v1|3e-74|51.8|282/437| RP:PFM:NREP 1 RP:PFM:REP 124->299|PF01512|8e-58|68.3|161/162|Complex1_51K| HM:PFM:NREP 3 HM:PFM:REP 124->297|PF01512|7.2e-50|46.6|148/151|Complex1_51K| HM:PFM:REP 323->373|PF10531|3e-11|27.5|51/59|SLBB| HM:PFM:REP 23->72|PF04695|0.00013|24.0|50/136|Pex14_N| GO:PFM:NREP 4 GO:PFM GO:0010181|"GO:FMN binding"|PF01512|IPR011538| GO:PFM GO:0016651|"GO:oxidoreductase activity, acting on NADH or NADPH"|PF01512|IPR011538| GO:PFM GO:0051287|"GO:NAD or NADH binding"|PF01512|IPR011538| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01512|IPR011538| RP:SCP:NREP 2 RP:SCP:REP 80->319|2fug12|2e-95|48.7|236/243|c.142.1.1| RP:SCP:REP 321->373|2fug13|9e-12|50.0|50/84|d.15.13.1| HM:SCP:REP 75->320|2fug12|1.7e-84|48.8|242/0|c.142.1.1|1/1|Nqo1 FMN-binding domain-like| HM:SCP:REP 321->376|2fug13|1.3e-13|45.3|53/0|d.15.13.1|1/1|Nqo1 middle domain-like| OP:NHOMO 1084 OP:NHOMOORG 722 OP:PATTERN -----------------------------1----1---------1--1----------1-1------- 11222---------12211-12--23111111322211111111-1--1-----1-----11211123411----------1-11112--1--1-----1-11--21111--------------1-----1---1-22222333111111111--11------11--11--------------11111331--------------------------------------------------------------1---------------------------------------------------------------------144-1111111111121------2-2113--23113436331211121--3--111111111233221133333311111111111-33333433221122223332223333112222333322311111111322-23111111111111111111111111111111121221-22112222222222222222222222223344412331331222223323321222121111111113232131-2-1--3-----343243275111111641--1---------------------11112---2---1-------------1----21--221111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111111111111114-121---------------11111111111-1111221122222-1111111111111--------------111111111111111111111111------------------------------------3223333333221 ----111-211-11111111111111111122111111121111111111111111111111111----1--211------1111111-12111111111111112-111115221-111-111111113A1-112--1111111-111-11-11111111111111411311211111H1112131341111131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 71.8 SQ:SECSTR ###################################################################################ccccccTTcTTcTHHHHHHTTcTHHHHHHHHccHHHHHHHHHTTTcccTTTTcccHHHHHTTcc#cc###cccccEEEEEcccccTTcccHHHHHHHcHHHHHHHHHHHHHHHTccEEEEEEcTTcHHHHHHHHHHHHHHHHTTcccTTGGGcccccEEEEEEccccGGGGcHHHHHHHHTTcccccccccccTTTccGGGccEEEEEHHHHHTHHHHHHccHHHHHTccccccccEEEEEEEccccccEEEEEETTccHHHHHHTTTc###cccccEEEEEccccccc##################### PSIPRED ccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccEEEccccccccccHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHcccccccccccHHHHHHHccccccccccccEEEEEEccccccccccHHHHHHccHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccccHHHHHHHHHcccccccccccccHHcccccccEEEccHHHHHHHHHHHHccHHHHHHHccccccccEEEEEEcccccccEEEEEccccHHHHHHHHccccccccccEEEEEcccccccccccHHccccccccccHHccc //