[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01622
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  52/199 : Viruses  0/175   --->[See Alignment]
b.85.7
:723 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   386->555 2c5sA PDBj 8e-04 14.3 %
:RPS:SCOP  36->307 1mlvA2  b.85.7.3 * 2e-13 18.0 %
:HMM:SCOP  30->305 1mlvA2 b.85.7.3 * 1.9e-23 30.7 %
:HMM:PFM   234->287 PF00856 * SET 0.00047 22.2 54/158  
:BLT:SWISS 73->535 YH9D_SCHPO 2e-17 27.1 %
:BLT:SWISS 595->669 SPRL1_COTJA 1e-04 31.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01624 GT:GENE CIRG_01622 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 723 SQ:AASEQ MSAEIGSMSLQVEGDMDVDASDGANSDSPPRSSPKSLLEWVKELGGGLADGIQLSTDPVKGQCLRVQHFLPENLASGTCVASCPIQATMSVANLEKIIKGVPSHGFLCSPEFLPAVKEKGASAFLLMDQYLLGDESFWAPYIRSLPEDSQLTRLEYYSDEDLEWLEGTNLLKLRENMLIKLKTTYEVGLQMLKESPNKNTKNYHLVSLLFQESAGISVPNKIFRERFLWASLDNYISRVLVRVLVPLLDMTNHQPLAQVEWRTSQGVVGLIVHKTLLPGQEVPNNYGPRNNERLMLNYGFCIPGNICDYRELSLKPPAGSPILVAKKEQYKRFATPGSIPNEDKYYVYNIFYPLPSQCRTLETSVFSLGLLDAVAVMSANRRELADLQIEENRIYIPFEKYGGSRCLLYGLGQLIKILMQTVLIIKTSACFKKEPKNSKQRNATFYREGQMYISECAIAIAEWTLQRAKSVEILCSDYSSWFDIVMKALPERRFNQRVLNKIQSLITDHPSSLKHGGELFYGDAVSQTLTRTAKEPFRACVRGILEAMGDPKGDIPTPFETKLVYTIFICFCAAAYRNIDQNENPSDDENRGILPARLRQWVAFLIEHYPEPPQDVRWVLEDDDAEKSLDSIEKIFKKTRRLKYGLFPLEYLINSWKVVDRMYWLSGNWMRWAWLITRDETVDLARSPLSFLMDVESVPRTLDQAPVDSYLYIPHDPRSVEAK BL:SWS:NREP 2 BL:SWS:REP 73->535|YH9D_SCHPO|2e-17|27.1|402/547| BL:SWS:REP 595->669|SPRL1_COTJA|1e-04|31.0|71/100| TM:NTM 1 TM:REGION 558->579| SEG 238->248|rvlvrvlvpll| RP:PDB:NREP 1 RP:PDB:REP 386->555|2c5sA|8e-04|14.3|168/372| HM:PFM:NREP 1 HM:PFM:REP 234->287|PF00856|0.00047|22.2|54/158|SET| RP:SCP:NREP 1 RP:SCP:REP 36->307|1mlvA2|2e-13|18.0|239/248|b.85.7.3| HM:SCP:REP 30->305|1mlvA2|1.9e-23|30.7|238/261|b.85.7.3|1/1|SET domain| OP:NHOMO 55 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------11--11111111111------1111111211----1-11---1-1111111--2111------------1111111----1----------11--1---------------------------------------------------------------------------------1-----1-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 23.2 SQ:SECSTR #################################################################################################################################################################################################################################################################################################################################################################################################EEEEcccEEEEEEEEEEccccccTTTTEEEEEEcccc##cHHHHHHHHHHHcTEEEEEEEEEcTTTccHHHHHHHHHHHHHHGGGcccEEEEEEEcHHHHHHHHHHccGGGHHHHHHHHHHHHHHHHHTTccEEEcccTTcccHHHHHHHGGGccccEEcTTTTccHHHH######################################################################################################################################################################## DISOP:02AL 722-724| PSIPRED ccccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHccEEEcccEEEEEEccccEEEEEEHHHccccccccEEEEEcHHHHccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccHHHHHEEEEEEEccccccccccccccccccccccEEEEccHHHHcccccccEEEEccccEEEEEEccccccccEEEEEcccccHHHHHHccccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHcccccccccEEccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccHHHccccHHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEcccEEEEEEEEccHHHHcccccHHHHHHccccccccHHHcccccEEEccccccccccc //