[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01624
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   40->153 PF03357 * Snf7 2e-04 21.9 %
:HMM:PFM   12->188 PF03357 * Snf7 1.7e-42 35.5 166/171  
:BLT:SWISS 1->155 CHMP5_PONAB 2e-28 39.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01627 GT:GENE CIRG_01624 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 213 SQ:AASEQ MNRLFGAKSAAPKPSLDGAIQNVEARVSNLDVKLAALNAELSTYQSKLSKMRDGPGKSALRQKALKVLQRRKQYEAQRDQLTQQSWNMEQAGMMQDNLRNVMTTVDAMKTTTKTLRQQYGKIDVDKIERLQDEMQDLMDIGNEIQDSISRSYDIPEDVDEAELDAELEMLNEEVMLSPEEGLPSFMQDEVAPPSFIDEPPEQNKVKEAAGGIE BL:SWS:NREP 1 BL:SWS:REP 1->155|CHMP5_PONAB|2e-28|39.4|155/219| SEG 101->114|vmttvdamktttkt| SEG 156->173|edvdeaeldaelemlnee| RP:PFM:NREP 1 RP:PFM:REP 40->153|PF03357|2e-04|21.9|114/170|Snf7| HM:PFM:NREP 1 HM:PFM:REP 12->188|PF03357|1.7e-42|35.5|166/171|Snf7| GO:PFM:NREP 1 GO:PFM GO:0015031|"GO:protein transport"|PF03357|IPR005024| OP:NHOMO 225 OP:NHOMOORG 178 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----111-211-111-111111111111112111111111111111111111111111-11-111111111-11111-1111111111-111111111111-1111-1211222221111111113-31141-111111111111-11111111-11111121111111261111-111H1111-224213111-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 213-214| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccc //