[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01654
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  18/915 : Eukaryota  28/199 : Viruses  0/175   --->[See Alignment]
b.58.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->130 1oruA PDBj 2e-04 26.9 %
:RPS:SCOP  11->158 1oruA  b.58.1.2 * 6e-08 23.9 %
:HMM:SCOP  1->180 1oruA_ b.58.1.2 * 1.9e-32 34.1 %
:HMM:PFM   31->175 PF03473 * MOSC 2.5e-08 24.2 120/133  
:BLT:SWISS 32->155 ODPB_ZYMMO 7e-04 26.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01657 GT:GENE CIRG_01654 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 188 SQ:AASEQ MSVLSVSLSSTHSFSKPPVPSITLLPNLGVQGDAHAGTTVQHLSRKHIQPPPLNLRQVHLIHAEVLSQASASTDIPLKPGQLGENITTTGINLLSLGKGTKLRFVGEEKPDDHDDAPVVMVTGLRNPCPQIDKFQAGLKEKFVVRDAQRKIVQRKAGIMGVVEVGGEVKPGMRIVVEKPAVHEPLECV BL:SWS:NREP 1 BL:SWS:REP 32->155|ODPB_ZYMMO|7e-04|26.3|114/100| SEG 2->10|svlsvslss| SEG 160->168|gvvevggev| BL:PDB:NREP 1 BL:PDB:REP 29->130|1oruA|2e-04|26.9|93/176| HM:PFM:NREP 1 HM:PFM:REP 31->175|PF03473|2.5e-08|24.2|120/133|MOSC| RP:SCP:NREP 1 RP:SCP:REP 11->158|1oruA|6e-08|23.9|138/182|b.58.1.2| HM:SCP:REP 1->180|1oruA_|1.9e-32|34.1|170/182|b.58.1.2|1/1|PK beta-barrel domain-like| OP:NHOMO 47 OP:NHOMOORG 46 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------11---11-----------1----1-2-------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1----------1-----------1----1---------------------------------------------------------------------------111-------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------- -------------------1111111-1111111111111111111-----------11-------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 49.5 SQ:SECSTR ############################ccTTcTTcccEEEccTTcTccTTcEccccEEEEEHHHHHHHHHHTcccccGGGGTccEEEEcTTGGGccTTcEEEc#########TTccEEEEEEEccccHH########################################################## DISOP:02AL 188-189| PSIPRED cEEEEEEEccccccEEcccccEEEEcccccccccccccccccccHHccccccccccEEEEEEHHHHHHHHHHccccccHHHHcccEEEEEEcHHHcccccEEEEEcccccccccccEEEEEccccccHHHHHHHcccHHHHHHccccccccccccccEEEEEEcccEEccccEEEEEEcccccccccc //