[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01667
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  16/915 : Eukaryota  172/199 : Viruses  0/175   --->[See Alignment]
c.2.1d.81.1
:401 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->401 1e5lA PDBj e-171 72.1 %
:RPS:PDB   15->401 1e5lA PDBj 3e-30 67.4 %
:RPS:SCOP  25->60 1ebfA1  c.2.1.3 * 4e-04 5.6 %
:RPS:SCOP  80->343 1e5lA2  d.81.1.2 * 5e-69 74.2 %
:HMM:SCOP  3->141 1e5qA1 c.2.1.3 * 2.2e-17 23.4 %
:HMM:SCOP  80->346 1ff9A2 d.81.1.2 * 1.4e-101 52.8 %
:RPS:PFM   7->250 PF03435 * Saccharop_dh 6e-37 41.4 %
:RPS:PFM   291->365 PF03435 * Saccharop_dh 2e-05 42.7 %
:HMM:PFM   3->391 PF03435 * Saccharop_dh 4.3e-118 41.2 328/386  
:BLT:SWISS 1->401 LYS9_MAGGR e-171 72.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01670 GT:GENE CIRG_01667 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 401 SQ:AASEQ MKNTTPISLDVNNSEALDAELSKNDLVISLIPYIHHATVIKAAIRTKKNVVTTSYVSPAMLELEKEAKEAGITVMNEIGLDPGIDHLYAVKTITEVHAAGGKITSFLSYCGGLPAPECSDNPLGYKFSWSSRGVLLALRNAAKYYKDGKIESVSGPELMGTAQPYFIYPGFAFVAYPNRDSTMYKERYHIPEAETVIRGTLRFQGFPAMIRALVDIGFLSDEPKDYLNSPIAWKEATKQVLGASSSDEKDLAWAISSKTEFPSTEEKNRIIAGLRWIGLFSDEKITPRGNPLDTLCATLEQKMQYGPGERDMVMLQHRFEIENKDGSKETRTSTLCDYGDPKGYSSMARLVGVPCAVAVKQVLDGTISEKGILAPMSMEICAPLIKALKEEYDIEMIEKTL BL:SWS:NREP 1 BL:SWS:REP 1->401|LYS9_MAGGR|e-171|72.1|401/450| SEG 61->70|lelekeakea| BL:PDB:NREP 1 BL:PDB:REP 1->401|1e5lA|e-171|72.1|401/449| RP:PDB:NREP 1 RP:PDB:REP 15->401|1e5lA|3e-30|67.4|386/449| RP:PFM:NREP 2 RP:PFM:REP 7->250|PF03435|6e-37|41.4|227/332|Saccharop_dh| RP:PFM:REP 291->365|PF03435|2e-05|42.7|66/332|Saccharop_dh| HM:PFM:NREP 1 HM:PFM:REP 3->391|PF03435|4.3e-118|41.2|328/386|Saccharop_dh| RP:SCP:NREP 2 RP:SCP:REP 25->60|1ebfA1|4e-04|5.6|36/168|c.2.1.3| RP:SCP:REP 80->343|1e5lA2|5e-69|74.2|264/267|d.81.1.2| HM:SCP:REP 3->141|1e5qA1|2.2e-17|23.4|137/183|c.2.1.3|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 80->346|1ff9A2|1.4e-101|52.8|267/267|d.81.1.2|1/1|Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain| OP:NHOMO 261 OP:NHOMOORG 192 OP:PATTERN -------------------11-------------------------------------1-1------- ------------------------------------------------------------1---1--1---------------------------------111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------1----------1----------------11----------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------- ----222-----22221111112232111111111111111111111111122211121111111111111111111-1111111111-53212322222211221-22241111121111111121--3A1-111111111111111111111112111351211111141111----------11-3221111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 401 STR:RPRED 100.0 SQ:SECSTR cTTEEEEEccTTcHHHHHHHHTccEEEEcccGGGHHHHHHHHHHHTTcEEEEcccccHHHHHTHHHHHHTTcEEEcccccTTcHHHHHHHHHHHHHHHHTcEEEEEEEEEEEEEcGGGcccTTccccccccTTTTTGGGccEEEEETTEEEEEcGGGTGGGcEEccccTTccEEEEEccccTTHHHHTTcTTccEEEEEEEEETTHHHHHHHHHHHTTTccccccGGGccccHHHHHHHHHTcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHTTTccccccccccHHHHHHHHHHHHccccTTccEEEEEEEEEEEEcTTccEEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHTcccccEEEccccHHHHHHHHHHHHHTTccccEEEEc DISOP:02AL 400-402| PSIPRED cccccEEEEEcccHHHHHHHHccccEEEEcccccccHHHHHHHHHccccEEEcccccHHHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccHHHHHHHHHccEEEEEccEEEEcccccHHHHHHccccccccEEEEEccccccccHHHHccccccEEEEEccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccEEEEEEEEEEEcccccEEEEEEEEEEEccccccEEHHHHHHHHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHHHccEEEEEEEc //