[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01682
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  47/199 : Viruses  0/175   --->[See Alignment]
:363 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->83 PF02116 * STE2 5e-05 33.3 %
:BLT:SWISS 114->175 HECA2_BOVIN 3e-04 32.3 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01685 GT:GENE CIRG_01682 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 363 SQ:AASEQ MTGKSTVYRFFYTTSFTILSVILFVLTLLTPGDIIYQSYTSHQIRNIFAITSVYIFTLLLVILIYASRIFTNRSIIAGIPKAWIPVEKPDVKKSVRRLVVEGLTRSAIIAQQARPRDRSGEDNSLSDQSLTISVDGPPPWGVVAHPGWTAPDCEDLPGQEFEPVIKELPHLIEAKAVSLAPTDPRFLPLEHGRSLDYSNAHENVEHTPDGRIVKILQRPLSMCLRDYMNHLDELGLINPPHLGDSFLKLYEKSRFSSHPLTETEFRAMMGTFAEILRGMTMLNPEIVASARMEGCSDDMASFSGRSGSNTGSSLSFASVRRTVSGPYRFPSFSSSGKASFRLRGGFDRQSFRSQSRTPSTKSI BL:SWS:NREP 1 BL:SWS:REP 114->175|HECA2_BOVIN|3e-04|32.3|62/100| TM:NTM 2 TM:REGION 13->35| TM:REGION 54->76| RP:PFM:NREP 1 RP:PFM:REP 18->83|PF02116|5e-05|33.3|66/281|STE2| GO:PFM:NREP 2 GO:PFM GO:0004932|"GO:mating-type factor pheromone receptor activity"|PF02116|IPR000366| GO:PFM GO:0016020|"GO:membrane"|PF02116|IPR000366| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------11111111111-111111111-1111111111111111111111111------------------------------1------------------------------------------------------------------------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 335-336,339-344,347-349| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccHHHccccccHHHHHHHHHHHccccHHHHHHHccccccccccccccccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccccccccccccccccEEHHHHHHHccccccccccccccccEEEEcccccHHHHHHHccccccccc //