[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01745
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  203/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
a.156.1b.113.1
:416 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->291 3c58A PDBj 2e-16 26.7 %
:RPS:PDB   2->291 1ee8A PDBj 3e-48 25.8 %
:RPS:SCOP  2->143 1k82A2  b.113.1.1 * 7e-23 25.6 %
:RPS:SCOP  155->243 1ee8A1  a.156.1.2 * 1e-15 29.9 %
:HMM:SCOP  2->162 1nnjA2 b.113.1.1 * 3.7e-26 32.3 %
:HMM:SCOP  155->250 1r2zA1 a.156.1.2 * 2.7e-25 42.9 %
:RPS:PFM   2->135 PF01149 * Fapy_DNA_glyco 2e-11 34.2 %
:RPS:PFM   155->246 PF06831 * H2TH 2e-11 35.6 %
:HMM:PFM   2->136 PF01149 * Fapy_DNA_glyco 1.3e-27 31.9 116/116  
:HMM:PFM   155->245 PF06831 * H2TH 9.8e-22 39.3 89/93  
:BLT:SWISS 1->291 FPG_BACSU 2e-21 32.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01748 GT:GENE CIRG_01745 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 416 SQ:AASEQ MPELAEVARIVHFIRKELVGKTVSSAVANHDDLIFGKVGTSAQEFQKTMQGNKIIGAGQQGKYFWMIMSKPPHPVMHFGMTGWLNIKGVNGCHYRAKEEEDDGPWPPKFWKFQLVMDDDKKTEAAFVDARRLGRVRLVDCPGEEIRSHTPLKENGPDPVIDKGIVTESWLKSIVSKKKVPIKALLLDQSIISGLGNWMADEVLYHSQIHPEQTSNTLDDSQIRELNSAIHYVCATSVDLLGDSARFPADWLMHHRWNKGKKEPSKMLNGDPVTFITVGGRTSAIVPAVQKKTHPTATNDKGGNAKEDVDDGSATKSRSKGRGKATVKETDETTTTNGNKRSTRISKASSVKAEEEKNTEGNDSAAQTPSRKRKAPAVKSEAAENAAGIAKKTRGNATKEAPSTTAPLRRGRSAAKK BL:SWS:NREP 1 BL:SWS:REP 1->291|FPG_BACSU|2e-21|32.6|267/276| SEG 171->182|ksivskkkvpik| SEG 325->335|tvketdetttt| BL:PDB:NREP 1 BL:PDB:REP 2->291|3c58A|2e-16|26.7|266/269| RP:PDB:NREP 1 RP:PDB:REP 2->291|1ee8A|3e-48|25.8|256/266| RP:PFM:NREP 2 RP:PFM:REP 2->135|PF01149|2e-11|34.2|117/118|Fapy_DNA_glyco| RP:PFM:REP 155->246|PF06831|2e-11|35.6|90/92|H2TH| HM:PFM:NREP 2 HM:PFM:REP 2->136|PF01149|1.3e-27|31.9|116/116|Fapy_DNA_glyco| HM:PFM:REP 155->245|PF06831|9.8e-22|39.3|89/93|H2TH| GO:PFM:NREP 10 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF01149|IPR012319| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF01149|IPR012319| GO:PFM GO:0006284|"GO:base-excision repair"|PF01149|IPR012319| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01149|IPR012319| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF01149|IPR012319| GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| RP:SCP:NREP 2 RP:SCP:REP 2->143|1k82A2|7e-23|25.6|121/128|b.113.1.1| RP:SCP:REP 155->243|1ee8A1|1e-15|29.9|87/89|a.156.1.2| HM:SCP:REP 2->162|1nnjA2|3.7e-26|32.3|130/131|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 155->250|1r2zA1|2.7e-25|42.9|91/0|a.156.1.2|1/1|S13-like H2TH domain| OP:NHOMO 302 OP:NHOMOORG 293 OP:PATTERN -------------------------------------------------------------------- --1----------11------1---------------11---------1--------------111-1--------------2--------------------1----1---------------1-----------11---1111-111-11-1111-----1111-111---------------1------1111111111-1111111111111111-111--1111111---------------------1111111111111111111-111111---1111-11-------------------------111111111--------------------------------111111111-1----------1111--1-----11---1-11-111111111-1-----------1--------1--------1111111111-1111111111111-----------------11-1111-11------111-1---------------------------------------------------------------------------11----1-------1-1--1--1----------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------1-1-1---1--1-111-11---11------------1- --------------1111111111111111111111111111111111111111111-1111111----1--1-1------11111---111111-2-111--111-12-------------------------------------------------------------------11111111132211211------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 291 STR:RPRED 70.0 SQ:SECSTR EccHHHHHHHHHHHHHHHTTcEEEEEEEcccHcccTTTccTTEEcGGGGTTEEEEEEEEETTEEEEEETTTEEEEEEcTTTcEEEccEETcccEEccccEcTTccccTTEEEEEEEccccHcEEEEEcTTcccEEEEEEEETTccTTcTHHHHccccTTcTTTcccHHHHHHHHHTccccHHHHHHHccccTTccHHHHHHHHHHTTccccccGGGccHHHHHHHHHHHHHHHHHHHHTTcccccccccccTGGcccTTcTTcccTTTccccEEEEccccEEEEcTTTTTc############################################################################################################################# PSIPRED ccccHHHHHHHHHHHHHHcccEEEEEEEccccEEcccccccHHHHHHHHHccEEEEEEEcccEEEEEEccccEEEEEcccEEEEEEEEccccccccccccccccccccccEEEEEEEccccEEEEEEcccccEEEEEEEccHHHHHHcHHHHHHccccccccccccHHHHHHHHccccccHHHHHHcccEEcccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEccccccccccEEEEccccccccccccEEEEEEEcccEEEEccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccHHHcccccccccccccccccccHHHHHcccccccccccccccccEEcccccccccccccHHcc //