[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01754
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  779/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
a.9.1b.84.1c.43.1
:483 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   54->129 1k8mA PDBj 1e-17 48.7 %
:BLT:PDB   184->225 1zwvA PDBj 1e-08 47.6 %
:BLT:PDB   261->483 2ihwA PDBj 2e-57 48.9 %
:RPS:PDB   22->124 3bg5B PDBj 2e-12 21.4 %
:RPS:PDB   174->223 1balA PDBj 2e-12 45.8 %
:RPS:PDB   251->479 1c4tA PDBj 1e-60 26.1 %
:RPS:SCOP  56->133 1y8nB1  b.84.1.1 * 2e-12 23.1 %
:RPS:SCOP  174->224 1balA  a.9.1.1 * 4e-13 44.9 %
:RPS:SCOP  245->480 1b5sA  c.43.1.1 * 8e-60 35.5 %
:HMM:SCOP  45->145 1y8oB1 b.84.1.1 * 2.8e-21 26.7 %
:HMM:SCOP  175->225 1balA_ a.9.1.1 * 2.4e-12 41.2 %
:HMM:SCOP  235->480 1eafA_ c.43.1.1 * 2.7e-70 40.2 %
:RPS:PFM   57->117 PF00364 * Biotin_lipoyl 1e-04 27.9 %
:RPS:PFM   186->220 PF02817 * E3_binding 3e-06 54.3 %
:RPS:PFM   254->480 PF00198 * 2-oxoacid_dh 1e-49 43.7 %
:HMM:PFM   249->480 PF00198 * 2-oxoacid_dh 1.4e-81 43.8 226/231  
:HMM:PFM   184->218 PF02817 * E3_binding 2.8e-18 51.4 35/39  
:HMM:PFM   56->123 PF00364 * Biotin_lipoyl 1.7e-15 25.0 68/74  
:BLT:SWISS 41->483 ODB2_BOVIN 1e-85 46.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01757 GT:GENE CIRG_01754 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 483 SQ:AASEQ MGSLYCRRSLSKALQARISSRILPAAPPVAGFNHRSRRRFHSTPVPWGIRSQILKDVGEGITEVQIIQWYVQEGARIEEWKPLCQYQSDKAVDDITSRYEGVIKKLHFQADDTVPTGMALCEIEVDDAKYPETNAPAPPKAESAPEPTTSASAVSQETAQEVLAENSQAQVETAPAAPKSKYATFATPAVRGLLKEHGLDITKITGTGKDGRVMKEDVFKYLAERDSQAAAPAAQPTATTPSVDTPQIETPTRLTPIQSQMFKTMTKSLSVPHFLYADDLSISALASIRQKILSHPTEPQKISFLPFIIKAVSLALQQYPLLNARVDTTTNPDKPSLVMRSSHNIGVAMDTPTGLLVPNIKNVQARSILDIAAEVTRLAAVARAGKLTPADLNGGTITVSNIGTIGGTYVAPVLVPNEVAILGVGRSRTVPVFDEQGNVVKDQKMTFNWSADHRVIDGATMARMAEKVRMYVESPETMMLALR BL:SWS:NREP 1 BL:SWS:REP 41->483|ODB2_BOVIN|1e-85|46.2|411/482| SEG 135->147|apappkaesapep| SEG 228->241|qaaapaaqptattp| BL:PDB:NREP 3 BL:PDB:REP 54->129|1k8mA|1e-17|48.7|76/87| BL:PDB:REP 184->225|1zwvA|1e-08|47.6|42/52| BL:PDB:REP 261->483|2ihwA|2e-57|48.9|219/234| RP:PDB:NREP 3 RP:PDB:REP 22->124|3bg5B|2e-12|21.4|103/1074| RP:PDB:REP 174->223|1balA|2e-12|45.8|48/51| RP:PDB:REP 251->479|1c4tA|1e-60|26.1|222/226| RP:PFM:NREP 3 RP:PFM:REP 57->117|PF00364|1e-04|27.9|61/74|Biotin_lipoyl| RP:PFM:REP 186->220|PF02817|3e-06|54.3|35/39|E3_binding| RP:PFM:REP 254->480|PF00198|1e-49|43.7|222/232|2-oxoacid_dh| HM:PFM:NREP 3 HM:PFM:REP 249->480|PF00198|1.4e-81|43.8|226/231|2-oxoacid_dh| HM:PFM:REP 184->218|PF02817|2.8e-18|51.4|35/39|E3_binding| HM:PFM:REP 56->123|PF00364|1.7e-15|25.0|68/74|Biotin_lipoyl| GO:PFM:NREP 5 GO:PFM GO:0005515|"GO:protein binding"|PF02817|IPR004167| GO:PFM GO:0008152|"GO:metabolic process"|PF02817|IPR004167| GO:PFM GO:0008415|"GO:acyltransferase activity"|PF02817|IPR004167| GO:PFM GO:0008152|"GO:metabolic process"|PF00198|IPR001078| GO:PFM GO:0008415|"GO:acyltransferase activity"|PF00198|IPR001078| RP:SCP:NREP 3 RP:SCP:REP 56->133|1y8nB1|2e-12|23.1|78/97|b.84.1.1| RP:SCP:REP 174->224|1balA|4e-13|44.9|49/51|a.9.1.1| RP:SCP:REP 245->480|1b5sA|8e-60|35.5|231/242|c.43.1.1| HM:SCP:REP 45->145|1y8oB1|2.8e-21|26.7|101/0|b.84.1.1|1/1|Single hybrid motif| HM:SCP:REP 175->225|1balA_|2.4e-12|41.2|51/51|a.9.1.1|1/1|Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex| HM:SCP:REP 235->480|1eafA_|2.7e-70|40.2|241/243|c.43.1.1|1/1|CoA-dependent acyltransferases| OP:NHOMO 2702 OP:NHOMOORG 993 OP:PATTERN 11------1111111---111---2111--11----------------------------1111---- 1222522222223242333-322242333333444435763444344433335564452234434264544-----------2---1-111--1--22133334333333333333333333332---1----12-34433---221111111111111111111111121111111111111333331--324444444443444444464454444455344322222242233333333333333344432-1-22-1---111111111111111111111112211111-111111111111111111211111111111---1111111-1--111---------3--------------11311-13-2422222222224223222222244444433443-224225232422233232533344223233242222232222222222222222222222222221122222222222222222235731232233443443333322243333243333333233332222222444222221112322222222223322-1-2----------323133421333333-21-----------------------1113223323343334333343333333333441-2422212222232222222222233322-222223322223222222323322232222222222222222222222222222222222222222223333333333223232222222222222223333323222324444333333333222222222222211223222223323333323222222222111-222221----------111111-1-11111111211111-------------222 33--444-833-3333333343344433333333333423333333333444443333333332222222222222222222222222-35333333333433545-3547466657434334445474Af4-74D3422524643444444254853459F36343434B54543534l434458AFC3B55494564 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 403 STR:RPRED 83.4 SQ:SECSTR #####################EEEEETTEEEEEEEEcccccccccccccccTTcTTEEEccccEEEEEEcccTTcEEcTTcEEEEEEccccEEEEEccccEEEEEEcccTTcEEcTTcEEEEEcccHHE#######################################cccccccccccccc#ccccGGGTTHHHHTTccTTccccccTTccccHHHHTTTccHH###################TccccccccccccccHHHHHHHHHHHccEEEEEEEEEcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHcEEEcccETTTTEEEccccccEEEcEEETTEEEccEEccTTTccHHHHHHHHHHHHHHHHTTcccTTTTccccEEEEEcGGGTcccccccccTTccEEEEEcccEEEEEEETcTEEEEEEEEEEEEEEETTTccHHHHHHHHHHHHHHHTcGGGTccTcc PSIPRED cEEEEEcHHHHHHHHHHHHHHHHccccccccccccccEEccccccccccEEEEcccccccccEEEEEEEEEccccEEccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEcccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHcccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEEEHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccEEEEEEEccccccccEEEEcccccEEEEEEccccEEEEEEcccHHccHHHHHHHHHHHHHHHHcccccHHHHccccEEEEccccccccEEEcccccccEEEEEEcccEEEEEEcccccEEEEEEEEEEEEEccEEEEHHHHHHHHHHHHHHHHHHHHHHHccc //