[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_01764
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
d.20.1
:139 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->139 2gmiB PDBj 2e-45 67.4 %
:RPS:PDB   4->139 2c2vC PDBj 3e-22 44.1 %
:RPS:SCOP  4->139 1j74A  d.20.1.1 * 5e-21 43.4 %
:HMM:SCOP  2->141 1j7dA_ d.20.1.1 * 1.6e-37 32.1 %
:RPS:PFM   42->125 PF00179 * UQ_con 1e-06 35.0 %
:HMM:PFM   25->128 PF00179 * UQ_con 3.6e-20 29.6 98/140  
:BLT:SWISS 3->139 MMS2_YEAST 5e-45 66.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_01767 GT:GENE CIRG_01764 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 139 SQ:AASEQ MTAKVPRNFRLLEELEKGEKGLGPEACSYGLADGEDIMMRNWNGTILGPPHSVHENRIYSVNIRCGDDYPDAPPLIQFVSRINLPCVDPRSGKVDPSRLPCLAEWKREFTMETILLELRRYMALPQHKKLPQPPEGATF BL:SWS:NREP 1 BL:SWS:REP 3->139|MMS2_YEAST|5e-45|66.9|136/137| SEG 11->23|lleelekgekglg| BL:PDB:NREP 1 BL:PDB:REP 4->139|2gmiB|2e-45|67.4|135/135| RP:PDB:NREP 1 RP:PDB:REP 4->139|2c2vC|3e-22|44.1|136/142| RP:PFM:NREP 1 RP:PFM:REP 42->125|PF00179|1e-06|35.0|80/137|UQ_con| HM:PFM:NREP 1 HM:PFM:REP 25->128|PF00179|3.6e-20|29.6|98/140|UQ_con| GO:PFM:NREP 3 GO:PFM GO:0019787|"GO:small conjugating protein ligase activity"|PF00179|IPR000608| GO:PFM GO:0043687|"GO:post-translational protein modification"|PF00179|IPR000608| GO:PFM GO:0051246|"GO:regulation of protein metabolic process"|PF00179|IPR000608| RP:SCP:NREP 1 RP:SCP:REP 4->139|1j74A|5e-21|43.4|136/139|d.20.1.1| HM:SCP:REP 2->141|1j7dA_|1.6e-37|32.1|140/0|d.20.1.1|1/1|UBC-like| OP:NHOMO 315 OP:NHOMOORG 186 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11-1111-311-11111111111111111111111111-11111111111111111111111111111-11111111-1111111111-11111111111111111-1112741124221221-562438J7-74212122223-1222111242321213-11111232111111111911111345416311-1111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 100.0 SQ:SECSTR ccccccHHHHHHHHHHHHHcccccTTEEEEEccTTcTTccEEEEEEEccTTcTTTTcEEEEEEEccTTTTTcccEEEEccccccTTccTTTccccccccHHHHTccTTccHHHHHHHHHHHTTcTTTTTcccccTTccc PSIPRED ccccccHHHHHHHHHHHHHHcccccEEEEcccccccccEEEEEEEEEccccccccccEEEEEEEEcccccccccEEEEEcccccccEEccccEEcHHHcccHHHccccccHHHHHHHHHHHHcccccccccccHHHccc //