[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02109
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  229/915 : Eukaryota  87/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:216 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->208 3gl5A PDBj 3e-18 31.6 %
:RPS:PDB   66->211 1bedA PDBj 9e-12 12.7 %
:RPS:SCOP  6->189 1r4wA  c.47.1.13 * 2e-34 17.6 %
:HMM:SCOP  2->216 1r4wA_ c.47.1.13 * 1e-39 28.8 %
:RPS:PFM   11->208 PF01323 * DSBA 2e-22 41.7 %
:HMM:PFM   6->208 PF01323 * DSBA 4.1e-43 29.9 187/193  
:BLT:SWISS 6->206 YWBO_BACSU 1e-13 36.6 %

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02112 GT:GENE CIRG_02109 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 216 SQ:AASEQ MTNFSIKIVSDTVCPWCYVGKKRLEKAIKLYRAAHPESNDTFSISWFPFYLNPNSPKSGIDKQAYYHQRFGPERSRMMQSRLEQVGQAEGINFKFGGRTGNTRDSHRLIQLAKTRGEDTQTRVVEELFAAYFENEGDITSHDTLTKAAVKAGLGEAEVKAWLESDQGGPEVDKEVQDAQRSFVSGVPNFTIQGKYEIGGAEDPQAFLEIFETIKKG BL:SWS:NREP 1 BL:SWS:REP 6->206|YWBO_BACSU|1e-13|36.6|172/200| BL:PDB:NREP 1 BL:PDB:REP 6->208|3gl5A|3e-18|31.6|196/231| RP:PDB:NREP 1 RP:PDB:REP 66->211|1bedA|9e-12|12.7|142/181| RP:PFM:NREP 1 RP:PFM:REP 11->208|PF01323|2e-22|41.7|168/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 6->208|PF01323|4.1e-43|29.9|187/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 6->189|1r4wA|2e-34|17.6|170/221|c.47.1.13| HM:SCP:REP 2->216|1r4wA_|1e-39|28.8|205/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 407 OP:NHOMOORG 318 OP:PATTERN --------------------------11---------------------------------------- ----1--1111--------------------------111-21111---11-111-11--111-11-11-1----------1-----------------1-1-1-111-1-----------------------------------------------------------1-------------111------11-----1-11111111--11111111112111------13---------------------1------1-1--11-----1----------------------------------------------------11-----------------------1---------------------1--211------11111--11111111111111111---1--1--111-122221111111--1111111111122--------111-1111-----------------------------11111-----12231211----1132------4122322-1--111111-1111--------------------111----------------------------11--------------------------------1----111------2--------------------------------------------------------------------------------------1--------------------------------------2---2-1---------11111-1121-1------11--1---211-------------111111--1--111111111111-1----11--11----------1-------------------------------------- ------------11132212222323311111-22221111111--2235325322312111---------------------------11121-111111---11--311------------------------------------------------1-1-11--------21-2223-1131111111222----2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 202 STR:RPRED 93.5 SQ:SECSTR #####EEEEEccccHHHHHHHHHHHHHH####ccccccTTTEEEcEEEcccccTTcccEEEEEcTHHHHHHHHHHHHHHTcHHcTTcEEEEEEcccccGGGHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHTTcccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHTcccccEEEETTTEEEcGcccHHHHHHHHH##### DISOP:02AL 216-217| PSIPRED cccEEEEEEEccccHHHHccHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEccEEEEcccccHHHHHHHHHHHHcc //