[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02115
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.66.1
:235 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   15->229 3c7xA PDBj 2e-09 25.4 %
:RPS:SCOP  16->207 1hxnA  b.66.1.1 * 4e-11 20.0 %
:HMM:SCOP  4->229 1genA_ b.66.1.1 * 9.2e-14 29.4 %
:HMM:PFM   5->29 PF00045 * Hemopexin 1.3e-05 52.2 23/45  
:HMM:PFM   71->93 PF00045 * Hemopexin 1.3e-06 42.9 21/45  
:HMM:PFM   134->173 PF00045 * Hemopexin 5.8e-07 35.3 34/45  
:HMM:PFM   194->215 PF00045 * Hemopexin 0.00032 50.0 22/45  
:BLT:SWISS 5->233 ALB2_PEA 1e-17 27.8 %
:REPEAT 4|17->56|74->113|131->175|195->234
:REPEAT 3|57->67|114->124|176->186
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02118 GT:GENE CIRG_02115 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 235 SQ:AASEQ MSVSINAALRVPGYQGEGYFFKGQRYLRMWWKPGTPEERKVFGPAKITDEWKIIRDAGFTSVDAMLPSTNDPQKVYAFSGNRYVRFSFVPGTPQESKIFGPAKIVDEWKSLRDAGFEKVDAVIPIPSTKKEEYEEEAYFFSGTQYIRVRYTPGTPKEEVVFGPTKITNEWKILRDAGFDTMDAFIPNSNSNTDVEVYGFRGTKYVRFRFTPGTPKEEVIFGPAGISENWATLREL BL:SWS:NREP 1 BL:SWS:REP 5->233|ALB2_PEA|1e-17|27.8|216/100| NREPEAT 2 REPEAT 4|17->56|74->113|131->175|195->234| REPEAT 3|57->67|114->124|176->186| SEG 131->136|eeyeee| RP:PDB:NREP 1 RP:PDB:REP 15->229|3c7xA|2e-09|25.4|173/196| HM:PFM:NREP 4 HM:PFM:REP 5->29|PF00045|1.3e-05|52.2|23/45|Hemopexin| HM:PFM:REP 71->93|PF00045|1.3e-06|42.9|21/45|Hemopexin| HM:PFM:REP 134->173|PF00045|5.8e-07|35.3|34/45|Hemopexin| HM:PFM:REP 194->215|PF00045|0.00032|50.0|22/45|Hemopexin| RP:SCP:NREP 1 RP:SCP:REP 16->207|1hxnA|4e-11|20.0|165/210|b.66.1.1| HM:SCP:REP 4->229|1genA_|9.2e-14|29.4|177/0|b.66.1.1|1/1|Hemopexin-like domain| OP:NHOMO 18 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------1---1--1---------1111111-----------------------------------------------8------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 80.9 SQ:SECSTR ###cccEEEEETTTTTEEEEEETTEEEEEETTEEcTcccc#TccEEHHHHcTTccc####cccEEEEEEcTTccEEEEETTEEEEEEEcTTccEEGGGTccccccc###########cccEEEEETTTTE######EEEEETTEEEEEETTTTE####EcTTccEEGGGccTccc###cccEEE####EcTTccEEEEEETTEE##EEEETTTTEEcTT#ccEEHHHHT###### PSIPRED ccEEEEEEEEEccccccEEEEEccEEEEEEEcccccccccccccEEEccccccccccccccccEEEEccccccEEEEEEccEEEEEEEccccccccccccHHHHHHcccccccccccccccccccccccccccccEEEEEcccEEEEEEccccccccccccccEEcccccccccccccccccEEEEccccccccEEEEEEccEEEEEEEcccccccccccccHHHHccccHHccc //