[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02129
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  0/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
g.39.1
:188 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->56 1jj2T PDBj 7e-09 41.2 %
:RPS:SCOP  1->68 1lv3A  g.39.1.9 * 3e-09 16.7 %
:HMM:SCOP  4->56 1ffkR_ g.39.1.6 * 2e-19 52.8 %
:RPS:PFM   1->68 PF01246 * Ribosomal_L24e 7e-17 57.4 %
:HMM:PFM   1->64 PF01246 * Ribosomal_L24e 1.2e-28 51.6 64/71  
:HMM:PFM   97->155 PF12082 * DUF3559 0.00054 32.0 50/311  
:BLT:SWISS 1->127 RLP24_SCHPO 7e-39 56.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02132 GT:GENE CIRG_02129 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 188 SQ:AASEQ MRVETCHLCSRPVYPSKGITFVRNDARTFRFCRSKCHKNFKMKRQPRKLKWTKTHRALRGKEMIVDSSLVLSQFAKKRNVPVKYDRNLVAATVKAMERVEEIRQRRERVFTKRRLAGKLAREKKRAEDRRVVAEGEHLIRKELQMLEKGVPLEEQRVKNAVVGKEQVRHKKKTRVLVDGGTQEEMDID BL:SWS:NREP 1 BL:SWS:REP 1->127|RLP24_SCHPO|7e-39|56.8|125/192| SEG 97->109|erveeirqrrerv| BL:PDB:NREP 1 BL:PDB:REP 6->56|1jj2T|7e-09|41.2|51/53| RP:PFM:NREP 1 RP:PFM:REP 1->68|PF01246|7e-17|57.4|68/69|Ribosomal_L24e| HM:PFM:NREP 2 HM:PFM:REP 1->64|PF01246|1.2e-28|51.6|64/71|Ribosomal_L24e| HM:PFM:REP 97->155|PF12082|0.00054|32.0|50/311|DUF3559| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01246|IPR000988| GO:PFM GO:0005622|"GO:intracellular"|PF01246|IPR000988| GO:PFM GO:0005840|"GO:ribosome"|PF01246|IPR000988| GO:PFM GO:0006412|"GO:translation"|PF01246|IPR000988| RP:SCP:NREP 1 RP:SCP:REP 1->68|1lv3A|3e-09|16.7|54/65|g.39.1.9| HM:SCP:REP 4->56|1ffkR_|2e-19|52.8|53/53|g.39.1.6|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 284 OP:NHOMOORG 199 OP:PATTERN ---1-1-----------------------------11-11-1--11--------11-1111------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1111111-311111211111111111111111111111111111111-1111111111111111111111111111111111111133-211122222222214321111-111-1-111111-32-211B3-11611-11-111-1---2111111111111112112211111212191111165581321112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 28.2 SQ:SECSTR ###cccTTTcccccccccEEEEcTTccEEEEccHHHHHHHHTTccGGGcTTcTTTc#################################################################################################################################### DISOP:02AL 188-189| PSIPRED cEEEEEEccccccccccccEEEEccccEEEEEcHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccc //