[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02130
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  182/199 : Viruses  0/175   --->[See Alignment]
a.2.3
:105 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   39->103 2guzA PDBj 7e-17 55.4 %
:RPS:PDB   28->95 3bvoB PDBj 9e-06 19.4 %
:RPS:SCOP  45->101 1gh6A  a.2.3.1 * 2e-06 21.1 %
:HMM:SCOP  41->104 1fafA_ a.2.3.1 * 3.7e-15 40.6 %
:HMM:PFM   56->103 PF00226 * DnaJ 1.8e-10 31.9 47/64  
:BLT:SWISS 26->103 TIM14_ASPFU 9e-36 84.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02133 GT:GENE CIRG_02130 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 105 SQ:AASEQ MTSVVAVGIGVAAAAFFGRAGLVALRRYRGGVNAMGRAFYKGGFEPRMNRREAALILELSERTLTKDKVRANHRKLMLLNHPDRGGSPYLATKINEAKELLEKTS BL:SWS:NREP 1 BL:SWS:REP 26->103|TIM14_ASPFU|9e-36|84.6|78/105| TM:NTM 1 TM:REGION 4->24| SEG 4->25|vvavgigvaaaaffgraglval| BL:PDB:NREP 1 BL:PDB:REP 39->103|2guzA|7e-17|55.4|65/71| RP:PDB:NREP 1 RP:PDB:REP 28->95|3bvoB|9e-06|19.4|67/172| HM:PFM:NREP 1 HM:PFM:REP 56->103|PF00226|1.8e-10|31.9|47/64|DnaJ| RP:SCP:NREP 1 RP:SCP:REP 45->101|1gh6A|2e-06|21.1|57/114|a.2.3.1| HM:SCP:REP 41->104|1fafA_|3.7e-15|40.6|64/79|a.2.3.1|1/1|Chaperone J-domain| OP:NHOMO 289 OP:NHOMOORG 183 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------- 1-11111-1---1111111111111-1111111111111111111111111111111111-122222221222212222221221111-1211-1111111--112-111122112222211325112-472-24522331-1432222225122322211-11111212811111111711-1113331311111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 72.4 SQ:SECSTR ###########################ccccccccccTTTcccccccccccHHHHTccccTccccHHHHHHHHHHHHHHHcGGGGTTccHHHHHHHHHHHHHH## PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc //