[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02132
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  399/915 : Eukaryota  198/199 : Viruses  3/175   --->[See Alignment]
d.144.1
:422 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->332 1tvoA PDBj 3e-92 54.7 %
:RPS:PDB   21->348 3e3pA PDBj 1e-60 21.7 %
:RPS:SCOP  13->319 1nw1A  d.144.1.8 * 2e-41 7.7 %
:HMM:SCOP  9->345 1howA_ d.144.1.7 * 1.1e-92 35.0 %
:RPS:PFM   27->310 PF00069 * Pkinase 5e-38 41.7 %
:HMM:PFM   23->314 PF00069 * Pkinase 4.7e-73 39.0 259/260  
:BLT:SWISS 8->360 SPM1_SCHPO e-150 71.1 %
:PROS 29->53|PS00107|PROTEIN_KINASE_ATP
:PROS 145->157|PS00108|PROTEIN_KINASE_ST
:PROS 58->161|PS01351|MAPK
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02135 GT:GENE CIRG_02132 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 422 SQ:AASEQ MADLQGRKVFKVFNQDFIVDERYNVTKEVGQGAYGIVCAASNVQTGEGVAIKKVTNVFSKKILAKRALREIKLLQHFRGHRNITCLYDMDIPRPDHFNEVYLYEELMECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPEALDLLDRMLAFDPSSRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKMILDEVMRFRAHVRQPHIQMGNAGQQAAAQQTSVPIPEENIASWKQDEPRPQEAIHGGMQPNDLEASLQGGMDAMRS BL:SWS:NREP 1 BL:SWS:REP 8->360|SPM1_SCHPO|e-150|71.1|353/422| PROS 29->53|PS00107|PROTEIN_KINASE_ATP|PDOC00100| PROS 145->157|PS00108|PROTEIN_KINASE_ST|PDOC00100| PROS 58->161|PS01351|MAPK|PDOC01049| SEG 368->376|agqqaaaqq| BL:PDB:NREP 1 BL:PDB:REP 12->332|1tvoA|3e-92|54.7|316/350| RP:PDB:NREP 1 RP:PDB:REP 21->348|3e3pA|1e-60|21.7|327/337| RP:PFM:NREP 1 RP:PFM:REP 27->310|PF00069|5e-38|41.7|247/256|Pkinase| HM:PFM:NREP 1 HM:PFM:REP 23->314|PF00069|4.7e-73|39.0|259/260|Pkinase| GO:PFM:NREP 3 GO:PFM GO:0004672|"GO:protein kinase activity"|PF00069|IPR017442| GO:PFM GO:0005524|"GO:ATP binding"|PF00069|IPR017442| GO:PFM GO:0006468|"GO:protein amino acid phosphorylation"|PF00069|IPR017442| RP:SCP:NREP 1 RP:SCP:REP 13->319|1nw1A|2e-41|7.7|273/365|d.144.1.8| HM:SCP:REP 9->345|1howA_|1.1e-92|35.0|326/362|d.144.1.7|1/1|Protein kinase-like (PK-like)| OP:NHOMO 34776 OP:NHOMOORG 607 OP:PATTERN -------------1----------1------------------2---2-------1-6---1------ 3Bs4E33333333344455-5722C7555557656566LG3B8C22324334547324224352B8CAA9A233333321115-------2-----1-----------1-111111111111111--------2--33365---D2C3854344411------21278763------------111221121222222222212222211111112221111--122223211111111-1111111111111111111111111111111-111111111111111111111-11111111111111111111111111111111121111111-1-11111----12111131111111111211111---E-T----------2--------------------------------1--------------11-2-----------111111111----1-----------------------------------------1-------------11--------1111------311--1-12--1131-11------------143-93221------------1-----75A7G*-1-----------------------1--------41-----1----1----1-----11------2---------------------2-----------1----------------------------1-1---------------------------2-----------7-1--------------------------31112---121-1-2--------------111-----11-----1-3--111-------------------------------111-1-----11--------1----------1 cacj***6*******u**rw*********u*V*vyvv*v*q***uyvw***w**rwxvy********zYy*******o**x*******-********wy*xst***K*************************j******************************************U****zrw******w********* --------------------------------------------------------------------------------------------------------------------------------------------------------------------------62-1- STR:NPRED 367 STR:RPRED 87.0 SQ:SECSTR EEcTTTcEEEccccTTcccGccHHHHHHHTTEcEEccEEEEETTTccEEEEEEEEccTTcccHHHHHHHHHHHHccTTcccEEEEEEEEccccTTcEEEEEEEEcccccHHHHHHHHHTTTccccHHHHHHHHHHHHHHHHHHTcTTTccccccccGGGEEEETTTTEEEEccTTcccccTTcccccTTccGGGccHHHHTTcccccTHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccHHHHHHHcTTcccGGGGccccccHHHHTTcccTTHHHHHHHHHHHTcccGGGcccHHHHTTcGGGGGGGcTTcccTTGGGGcccHHHHHHccHHHHHHHHHHHTcccEEcccTTccEH####################################################### PSIPRED ccccccEEEEEEccccccccccEEEEEEEcccccEEEEEEEEcccccEEEEEEEEcccccccHHHHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEEEccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHEEEccccEEEEcccccHHHcccccccccccccccEEEcccccHHHEEccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHccccccccHHHHcccccHHHHHHHHHHccccccccccHHHHHccHHHcccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcc //