[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02172
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
b.34.13
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   233->266 2dntA PDBj 1e-04 45.5 %
:RPS:PDB   232->265 2b2uA PDBj 3e-08 23.5 %
:RPS:SCOP  211->267 1x3qA1  b.34.13.2 * 1e-09 20.4 %
:HMM:SCOP  199->275 1guwA_ b.34.13.2 * 1.3e-11 35.7 %
:HMM:PFM   214->265 PF00385 * Chromo 1.2e-10 36.0 50/55  
:BLT:SWISS 233->275 CDYL1_HUMAN 2e-04 38.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02175 GT:GENE CIRG_02172 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 300 SQ:AASEQ MAAAIDLNNIVFYNPHSEPQQPPRPPRPFRPFKPFKPGAQSQLSSISSPNHQVPPAFPTPHPPIAGCHAAANQQRPELTDPPSNNFDQWLRVLEVVETGNLTHNDSLADQCFNIRLLDHQQPCLRGDGATECEIAIRQSKPMQGASDLLIPDSHASDQQISPMSAGRPANDKKPEHKNNCRRSSDADSLPEQQEPPPPPVLVDRNRVAAPEWPVDGIINSRMVVGRRGRVRLEYLVDWRGYTPSWQPRRDLIPGCEELVDEFHKRYPNQPSPADLDGGQRPKRRGRPPSGHRRKRVCLGI BL:SWS:NREP 1 BL:SWS:REP 233->275|CDYL1_HUMAN|2e-04|38.1|42/598| SEG 19->37|pqqpprpprpfrpfkpfkp| SEG 54->63|ppafptphpp| SEG 189->202|lpeqqepppppvlv| SEG 221->231|rmvvgrrgrvr| SEG 277->295|ggqrpkrrgrppsghrrkr| BL:PDB:NREP 1 BL:PDB:REP 233->266|2dntA|1e-04|45.5|33/78| RP:PDB:NREP 1 RP:PDB:REP 232->265|2b2uA|3e-08|23.5|34/173| HM:PFM:NREP 1 HM:PFM:REP 214->265|PF00385|1.2e-10|36.0|50/55|Chromo| RP:SCP:NREP 1 RP:SCP:REP 211->267|1x3qA1|1e-09|20.4|49/55|b.34.13.2| HM:SCP:REP 199->275|1guwA_|1.3e-11|35.7|70/0|b.34.13.2|1/1|Chromo domain-like| OP:NHOMO 16 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------21-1-----12221-112---------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 65 STR:RPRED 21.7 SQ:SECSTR #################################################################################################################################################################################################################ccccEEEEEEEEEEEcccccEEccEEEEETTccGEEEcHHHHHHHHHHHHHHHHHTTTccccccc########################## DISOP:02AL 300-301| PSIPRED cccccccccEEEEccccccccccccccccccccccccccccccHHccccccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHccccHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccHHHHHccccccccccccccccccccEEccccccccHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEcc //