[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02183
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  36/915 : Eukaryota  66/199 : Viruses  0/175   --->[See Alignment]
a.102.1d.145.1
:567 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   130->311 2bvfA PDBj 6e-08 28.0 %
:RPS:PDB   112->553 2bvfA PDBj 2e-35 18.9 %
:RPS:SCOP  119->302 1w1oA2  d.145.1.1 * 4e-22 19.2 %
:RPS:SCOP  459->553 1h12A  a.102.1.2 * 3e-08 8.4 %
:HMM:SCOP  120->303 1e8gA2 d.145.1.1 * 3.5e-37 30.8 %
:RPS:PFM   517->553 PF08031 * BBE 9e-06 43.2 %
:HMM:PFM   124->269 PF01565 * FAD_binding_4 1.3e-20 24.6 134/138  
:HMM:PFM   516->555 PF08031 * BBE 1.5e-12 32.5 40/47  
:BLT:SWISS 244->553 YVDP_BACSU 1e-07 23.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02186 GT:GENE CIRG_02183 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 567 SQ:AASEQ MASQAEFVTPSAVNATMKASAVVGHRQRCSYGDSCWPTEGEWQSFNASVSGHLIRTYPSAAVCHAERYDDAKCTAAKENWLDSFWRTNQTGAYSAILWELGENGQCFIDSPRDAPCDQGIVPHYSVNIQSTSDIQTAVKFAAQKELYLTVKNTGHDHLGRSSGQGAFSLWTHNMKGREWHTSFIPKGAPQETTGIPAVTLQAGEQWLDVYRAAAENGVIVVGGSARTVGAAGGYLTGGGHSPFSHFYGLAVDNLLEVNLVDANGTPRTINQYTDPEYFYALRGGGGSAWGVITSVTYKTHPSPSHIQVGLVQFNVTNNSTLRAVIEKCLQELPSITDAGYTGYGSMNFLSGGKEPLGFGAIFIQPNGTNATFTRTFKPYYDIAKMQGVSGALANIDFPSWIEYAEVFVQDPNIATNIIDGSRLLTSQALLHRTRDLVDLMFEYASFGPGFNFIGKVSSAKRDETSTHPIWEQSRALLSFAANWRDDASANEKRNAKLSLVEISKKLGDIVGPGGGTYVNEANPYEPDWQNVFWGEKYARLLAIKKRIDPTNLFVCNRCVGTDIVLEP BL:SWS:NREP 1 BL:SWS:REP 244->553|YVDP_BACSU|1e-07|23.1|290/447| SEG 229->239|gaaggyltggg| BL:PDB:NREP 1 BL:PDB:REP 130->311|2bvfA|6e-08|28.0|168/453| RP:PDB:NREP 1 RP:PDB:REP 112->553|2bvfA|2e-35|18.9|419/453| RP:PFM:NREP 1 RP:PFM:REP 517->553|PF08031|9e-06|43.2|37/45|BBE| HM:PFM:NREP 2 HM:PFM:REP 124->269|PF01565|1.3e-20|24.6|134/138|FAD_binding_4| HM:PFM:REP 516->555|PF08031|1.5e-12|32.5|40/47|BBE| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF08031|IPR012951| GO:PFM GO:0050660|"GO:FAD binding"|PF08031|IPR012951| RP:SCP:NREP 2 RP:SCP:REP 119->302|1w1oA2|4e-22|19.2|177/206|d.145.1.1| RP:SCP:REP 459->553|1h12A|3e-08|8.4|95/404|a.102.1.2| HM:SCP:REP 120->303|1e8gA2|3.5e-37|30.8|169/0|d.145.1.1|1/1|FAD-binding domain| OP:NHOMO 460 OP:NHOMOORG 102 OP:PATTERN -------------------------------------------------------------------- -------------------------1------------11--1---------1-1-----------11-----------------------------------------------------------------------------1--------------------------1--------------------------------------------1---1---------------------------------------------------------------------------------------------------------1---112------------------------------------------1-----------------------------------------1--------------1--------------------------------------------------------------------------------------------------1------------------------------------------------------------1-----1------------------------------------------1111-----------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------111-11--1---------------------------------------------------------------------------------------- ----2---------153D9CBE6IEIC3333345443222222211C97DBAGF778E8444---------------------------5343C13------2-----21------------------------------------------------------3-----------12-------3---F-N-----2- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 559 STR:RPRED 98.6 SQ:SECSTR ###EEEcHHHHccTTcccHHHHHTTcccccccHHHHHHHHHHHHHcccccHHHHHcccccccTTccHHHHHHHHHHHHHHcGGGEEEccccccccGccccccccccccccTccccTTccccccEEEEcccHHHHHHHHHHHHHHTccEEEEcccccTTcTTcccccEEEEcTTcccEEEETTTEEcTTTTTTETETEEEEETTccHHHHHHHHHTTTEEEcccccTTccHHHHHTTcccccTTHHHHccGGGGEEEEEEEcTTccEEEEEccccHHHHHHHHHHGGGcTcEEEEEEEEEEEccccEEEEEEEEcEccHHHHHHHHHHHHHHHHHTTTTTTcccEEEEEEcTTccEHHEEEEEEEccccHHHHHHHHHHHHTTccccEEccEEEcHHHHHHHHHHcccccccEEEEEEEEEcccHHHHHHHHHHHTTGGGcEEETTTTEEEEEEEEcTGcccccTTccccccccccEEEEEEEEcTTcTTTTHHHHHHHHHHHHHHHTTcEEEEEccGGGcccccHHHHHHHHcHHHHHHHHHHHHHHcTTcccccTTccccc##### PSIPRED cccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccccEEEEEccccccEEEEcccccccccccccccEEEEEEccccHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccHHHEEEEEEEEEccccEEEEcccccHHHHHHHHHcccccEEEEEEEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHccccccccEEEEEEccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHcccccccccccccccccccc //