[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02503
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:359 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->356 1agrA PDBj 6e-81 43.2 %
:RPS:PDB   38->353 3d7mA PDBj 3e-50 45.2 %
:RPS:SCOP  9->58 1agrA2  c.37.1.8 * 9e-07 52.0 %
:RPS:SCOP  138->354 1agrA2  c.37.1.8 * 2e-27 38.7 %
:HMM:SCOP  36->355 2bcjQ2 c.37.1.8 * 6e-52 33.8 %
:RPS:PFM   18->356 PF00503 * G-alpha 1e-93 47.9 %
:HMM:PFM   12->358 PF00503 * G-alpha 7.6e-133 44.5 346/351  
:BLT:SWISS 3->359 GPA2_NEUCR e-109 53.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02506 GT:GENE CIRG_02503 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 359 SQ:AASEQ MGCSGSKEISPEERQAIKQNASIDKMIRMDKKTYDRTVKILLLGAGESGKSTIIKQMRIIHAGGFPEDERRQTRAIIYSNMIVAFKILLDIMEAEGIEFEAADTKSFAQVIEETEADVESDEAFTDLNVRQAMKSMWADPGVQKAVAKGHEFALHDNLDYYFNSLDRIFTPGWLPNNQDMLHSRLRTTGITETLFELGQINFRMMDVGGQRSERKKWIHCFEGVQCLLFMVALSGYDQCLVEDQTANQMHEAMMLFESLVNGEWFRRKPVILFLNKIDLFKQKVPTSPVSKHFPDFKGPDGDYQAATKFFSDRFKGMTRMPEREIYVHHTNATDTTLLKATMDSVQDMIIQKNLNNLVL BL:SWS:NREP 1 BL:SWS:REP 3->359|GPA2_NEUCR|e-109|53.4|352/355| TM:NTM 1 TM:REGION 74->96| BL:PDB:NREP 1 BL:PDB:REP 9->356|1agrA|6e-81|43.2|345/350| RP:PDB:NREP 1 RP:PDB:REP 38->353|3d7mA|3e-50|45.2|305/305| RP:PFM:NREP 1 RP:PFM:REP 18->356|PF00503|1e-93|47.9|336/344|G-alpha| HM:PFM:NREP 1 HM:PFM:REP 12->358|PF00503|7.6e-133|44.5|346/351|G-alpha| GO:PFM:NREP 3 GO:PFM GO:0004871|"GO:signal transducer activity"|PF00503|IPR001019| GO:PFM GO:0007186|"GO:G-protein coupled receptor protein signaling pathway"|PF00503|IPR001019| GO:PFM GO:0019001|"GO:guanyl nucleotide binding"|PF00503|IPR001019| RP:SCP:NREP 2 RP:SCP:REP 9->58|1agrA2|9e-07|52.0|50/229|c.37.1.8| RP:SCP:REP 138->354|1agrA2|2e-27|38.7|217/229|c.37.1.8| HM:SCP:REP 36->355|2bcjQ2|6e-52|33.8|201/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1697 OP:NHOMOORG 177 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----DC3-----9953443333344433332333333333433333333333442333333322222222212122222222222222-7LC4GEi3333844CAB-75aEVbQTVMFE8BEKFRKBPHl*M-QJTCEBCIGGKL8GEBBGCAHFFDGDCDID9998RH9EIN68----------12264431211114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 351 STR:RPRED 97.8 SQ:SECSTR ########cHHHHHHHHHHHHHHHHHHHHHHHHHTTEcEEEEEEcTTccHHHHHHHHHHHHcccccHHHHHTTHHHHHHHHHHHHHHHHHHHHHHTcccccTTHHHHHHHHHHHccHHHHTcccHHHHHHHHHHHHHHcHHHHHHHHGGGGccccTTHHHHHHcHHHHTcTTccccHHHHHHcccccccEEEEEEEETTEEEEEEEEcccTTTTTTTGGGcccccEEEEEEEGGGTTccccccTTccHHHHHHHHHHHHHHcGGGcccEEEEEEEcHHHHHHHGGGccGGGTcTTccccccHHHHHHHHHHHHHTTcccGGGccEEEEEccTTcHHHHHHHHHHHHHHHHHHcHGGccc DISOP:02AL 358-360| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHccccccccEEEEEEEEccEEEEEEEcccccccccHHHHHcccccEEEEEEEcccccccHHHccHHHHHHHHHHHHHHHHccHHHccccEEEEEcHHHHHHHHHccccHHHcccccccccccHHHHHHHHHHHHHHcccccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcc //