[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02508
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  80/199 : Viruses  0/175   --->[See Alignment]
f.23.13
:99 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   8->91 3cx5H PDBj 6e-17 45.8 %
:RPS:PDB   8->91 3cx5H PDBj 4e-30 45.8 %
:RPS:SCOP  8->91 1ezvG  f.23.13.1 * 3e-30 45.8 %
:HMM:SCOP  6->99 1ezvG_ f.23.13.1 * 2.6e-31 58.1 %
:RPS:PFM   16->91 PF02939 * UcrQ 2e-22 65.3 %
:HMM:PFM   16->91 PF02939 * UcrQ 4.6e-31 56.0 75/80  
:BLT:SWISS 2->99 QCR8_NEUCR 2e-27 55.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02511 GT:GENE CIRG_02508 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 99 SQ:AASEQ MGGASADPKNGVYMGGWGNFGTPHPQRGIITYSLAANRQRPLAGALHNAIFNTWRRCKAQFLYVVPPFVLAYAAMNWAVERNEYLNSKPGRLAEGVSEE BL:SWS:NREP 1 BL:SWS:REP 2->99|QCR8_NEUCR|2e-27|55.7|97/107| TM:NTM 1 TM:REGION 58->80| BL:PDB:NREP 1 BL:PDB:REP 8->91|3cx5H|6e-17|45.8|83/93| RP:PDB:NREP 1 RP:PDB:REP 8->91|3cx5H|4e-30|45.8|83/93| RP:PFM:NREP 1 RP:PFM:REP 16->91|PF02939|2e-22|65.3|75/80|UcrQ| HM:PFM:NREP 1 HM:PFM:REP 16->91|PF02939|4.6e-31|56.0|75/80|UcrQ| GO:PFM:NREP 1 GO:PFM GO:0008121|"GO:ubiquinol-cytochrome-c reductase activity"|PF02939|IPR004205| RP:SCP:NREP 1 RP:SCP:REP 8->91|1ezvG|3e-30|45.8|83/93|f.23.13.1| HM:SCP:REP 6->99|1ezvG_|2.6e-31|58.1|93/93|f.23.13.1|1/1|Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)| OP:NHOMO 85 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------1111-11121-2111111111-11111111111111111111-11111-111111111111111111111111-12-11-----1-11112---------------------------------------------------1-------------------------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 84.8 SQ:SECSTR #######cccccccccTTcccccccccccccccccGGGcccccccTTTTcccccHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHTcGGGH######## PSIPRED ccccccccccccEEEccccccccccEEEEEEEEEcHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccccc //