[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02562
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  134/199 : Viruses  0/175   --->[See Alignment]
d.88.1
:222 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   52->134 1mnmA PDBj 4e-27 80.7 %
:RPS:PDB   54->119 1egwB PDBj 3e-14 30.3 %
:RPS:SCOP  49->134 1hbxA  d.88.1.1 * 2e-18 53.5 %
:HMM:SCOP  53->145 1n6jA_ d.88.1.1 * 7.9e-23 36.6 %
:RPS:PFM   62->110 PF00319 * SRF-TF 9e-06 36.7 %
:HMM:PFM   60->110 PF00319 * SRF-TF 3.5e-26 49.0 51/51  
:BLT:SWISS 52->133 MCM1_YEAST 2e-26 81.7 %
:PROS 54->108|PS00350|MADS_BOX_1
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02565 GT:GENE CIRG_02562 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 222 SQ:AASEQ MTDITAVADENPSPTQEDLVPGGNGAVENRGTKRPRLSTAEDDDDDEDKPGRERRKIEIKFIQDKSRRHITFSKRKAGIMKKAYELSVLTGTQVLLLVVSETGLVYTFTTPKLQPLVTKAEGKNLIQSCLNAPEPTSAENGVEAPEVPSETTDDVSHASVSAQQAQIPRPGPMHPGYMTADQQQQMAYYQNLQQQQQQAQAGGQYPGMPVGGRIPPQHQPTA BL:SWS:NREP 1 BL:SWS:REP 52->133|MCM1_YEAST|2e-26|81.7|82/286| PROS 54->108|PS00350|MADS_BOX_1|PDOC00302| SEG 41->48|eddddded| SEG 86->100|lsvltgtqvlllvvs| SEG 182->207|qqqqmayyqnlqqqqqqaqaggqypg| BL:PDB:NREP 1 BL:PDB:REP 52->134|1mnmA|4e-27|80.7|83/85| RP:PDB:NREP 1 RP:PDB:REP 54->119|1egwB|3e-14|30.3|66/72| RP:PFM:NREP 1 RP:PFM:REP 62->110|PF00319|9e-06|36.7|49/51|SRF-TF| HM:PFM:NREP 1 HM:PFM:REP 60->110|PF00319|3.5e-26|49.0|51/51|SRF-TF| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00319|IPR002100| GO:PFM GO:0005634|"GO:nucleus"|PF00319|IPR002100| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00319|IPR002100| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00319|IPR002100| RP:SCP:NREP 1 RP:SCP:REP 49->134|1hbxA|2e-18|53.5|86/87|d.88.1.1| HM:SCP:REP 53->145|1n6jA_|7.9e-23|36.6|93/93|d.88.1.1|1/1|SRF-like| OP:NHOMO 188 OP:NHOMOORG 134 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ----21-------1111111111111111111111-1111131111-111111111111111111111-1331112212221111111-1211111111121165611-1232223-1------11-1-281-223-1--1-113-1---1--3---11--11111121-11111--------------1--------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 38.7 SQ:SECSTR ################################################cTTcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcccEEEEEcTTccEEEEEcccHHHHHHHHHHHHHHHHHHTccc######################################################################################## PSIPRED cccEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEcccccHHHHHHHHHcccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc //