[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02585
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  766/915 : Eukaryota  197/199 : Viruses  0/175   --->[See Alignment]
b.62.1
:162 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->153 1xwnA PDBj 2e-54 62.0 %
:RPS:PDB   5->153 2b71A PDBj 6e-52 60.4 %
:RPS:SCOP  6->156 1a33A  b.62.1.1 * 4e-43 48.0 %
:HMM:SCOP  3->156 1zkcA1 b.62.1.1 * 7.5e-68 56.5 %
:RPS:PFM   7->151 PF00160 * Pro_isomerase 4e-41 58.3 %
:HMM:PFM   6->154 PF00160 * Pro_isomerase 9.2e-56 50.0 146/155  
:BLT:SWISS 1->162 PPIL1_ASPNG 5e-85 88.9 %
:PROS 39->56|PS00170|CSA_PPIASE_1

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02588 GT:GENE CIRG_02585 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 162 SQ:AASEQ MATDVVIDTTMGSITVELYNDHAPKTCKNFSTLAQRGYYNNVIFHRIIPDFMVQTGDPTGTGRGGSSIYGEKFEDEINPSLKHTGAGVLSMANSGPNTNGSQFFITLAPTPWLDGKHTIFGRVKSGMRVMQRMGLVKTDGDDRPVDQVKILKARVVEETGDE BL:SWS:NREP 1 BL:SWS:REP 1->162|PPIL1_ASPNG|5e-85|88.9|162/162| PROS 39->56|PS00170|CSA_PPIASE_1|PDOC00154| BL:PDB:NREP 1 BL:PDB:REP 4->153|1xwnA|2e-54|62.0|150/166| RP:PDB:NREP 1 RP:PDB:REP 5->153|2b71A|6e-52|60.4|149/169| RP:PFM:NREP 1 RP:PFM:REP 7->151|PF00160|4e-41|58.3|144/151|Pro_isomerase| HM:PFM:NREP 1 HM:PFM:REP 6->154|PF00160|9.2e-56|50.0|146/155|Pro_isomerase| GO:PFM:NREP 2 GO:PFM GO:0003755|"GO:peptidyl-prolyl cis-trans isomerase activity"|PF00160|IPR002130| GO:PFM GO:0006457|"GO:protein folding"|PF00160|IPR002130| RP:SCP:NREP 1 RP:SCP:REP 6->156|1a33A|4e-43|48.0|150/174|b.62.1.1| HM:SCP:REP 3->156|1zkcA1|7.5e-68|56.5|154/0|b.62.1.1|1/1|Cyclophilin-like| OP:NHOMO 4744 OP:NHOMOORG 992 OP:PATTERN ------------------------11111111111---222212211111111--------1----22 2252411122111221112-11221111111113233111111112111111112112--3211312142211111112121---1--1111-1-----123333-2222--------------111111211232222221112-4112111221123321231131-23121311121311333-----111111111111111111211111111-11221111111133111111111111111111112111111111111111111122122222222222222222222222212222222222222222222222-211211111112122111122221111221211111-1---------222-4233122222222222222222222222222222-22222222222-2222222222222211122222222221111111111111121--------11-------------------232222111112222222222222222222222222222222222222222222222223222222222222222221221113221122222221222223223421221111--1-111111111112211211212223323124444433444443444434--211-1------22222222222222122-2222222222222222222222222222222222222222222222222222-222222222222---2-----22221221211111211111111222222121112222222222222221222---------233332222233322111111111111112112222222---1-111112------------------------------------32 9877CCF-YCJ2EEFBCBB9BBBBCCAAA99999A89BAAAAAAA9BAAAAAAA9AAAABAA988666565775777667666766A9-DKDCEDCDDDCBC9EEG2AoIhOOLKQOFCKFGHFVZD*F**f1UTtLECCMBHMHDIEFKJEGPALGGJJQTHEIBDHCHSIKHE3KKM*JIJGGXHTgCRIGIJIJGa ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 161 STR:RPRED 99.4 SQ:SECSTR cccEEEEEETTEEEEEEEcTTTcHHHHHHHHHHHHTTTTTTEEEEEEETTTEEEEEETTccccccccTTcccccccccTTcccccTTEEEEccccTTcccccEEEEccccGGGTTTccEEEEEEEcHHHHHHHHTccccTTcccccccEEEEEEEEEcEEE# DISOP:02AL 162-163| PSIPRED cccEEEEEccccEEEEEEccccccHHHHHHHHHHHcccccccEEEEEEccEEEEEcccccccccccccccccccccHHcccccccEEEEEEEEccccccccEEEEEccccccccccEEEEEEEEccHHHHHHHHHccccccccEEccEEEEEEEEEcccccc //