[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02586
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  147/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.16.1
:532 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   12->296 1vg9C PDBj 2e-23 32.2 %
:RPS:PDB   9->49 2bs2A PDBj 6e-05 19.5 %
:RPS:SCOP  10->48 1kdgA1  c.3.1.2 * 2e-04 33.3 %
:RPS:SCOP  349->465 1ltxR2  d.16.1.6 * 1e-11 18.8 %
:HMM:SCOP  9->422 1ltxR1 c.3.1.3 * 2.1e-30 26.0 %
:RPS:PFM   12->440 PF00996 * GDI 6e-38 34.5 %
:RPS:PFM   430->518 PF05918 * API5 6e-04 37.5 %
:HMM:PFM   9->452 PF00996 * GDI 6.7e-47 29.0 379/439  
:BLT:SWISS 13->423 RAEP_YEAST 1e-36 30.0 %
:BLT:SWISS 422->501 ENV2_DROME 5e-04 25.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02589 GT:GENE CIRG_02586 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 532 SQ:AASEQ MLGQNTLNDTTWDVLISGTGLPQSLLALALSRSGKKVLHIDKNDYYGGSEAAFSLQEAEHWVNKVGCEPNFGPFESASVWRSPSTEKKENGKLSFSRAYTLSLSPQLIYTRSKLLPSLVSSKVYRQLEFQAMGNWWVYRDEAQVETGSQEHAIRGLQCVPSSREDVFADDTLTMKSKRSLMKFLRYLGQSDESGSSSTEEGDFDTPFSTFLRSKFQVHSDLYYPLLCLCLSPHSISQTTAGYALPKIKRHLQSIGVFGPGFSSVVTKWGGASEIAQVACRACAVGGGVYALNRGIRSVGPPAQGSPDGDSSLRRVCLSDGETVCTRYIVGTPWDIPADTQKAELPTLTKVSRSVMIVSSPLEALFPPMAENDPVAAGTLVIFPGQQAAGEDAIDEPPLYLLLHSSDTGECPFGQCIIYASVLQPSSKGHPRIDSAVQQLLKSTDPVAEVLWKMQFTQLGHLGTDILPKDGLAGVDSQILVFPSPCLDLEFNDSMIDQVRHVWKDIMGADADENEFLVFENREAAEEENMSAS BL:SWS:NREP 2 BL:SWS:REP 13->423|RAEP_YEAST|1e-36|30.0|370/603| BL:SWS:REP 422->501|ENV2_DROME|5e-04|25.0|80/471| SEG 112->123|skllpslvsskv| SEG 188->204|gqsdesgsssteegdfd| SEG 219->232|sdlyypllclclsp| BL:PDB:NREP 1 BL:PDB:REP 12->296|1vg9C|2e-23|32.2|264/502| RP:PDB:NREP 1 RP:PDB:REP 9->49|2bs2A|6e-05|19.5|41/655| RP:PFM:NREP 2 RP:PFM:REP 12->440|PF00996|6e-38|34.5|365/385|GDI| RP:PFM:REP 430->518|PF05918|6e-04|37.5|80/433|API5| HM:PFM:NREP 1 HM:PFM:REP 9->452|PF00996|6.7e-47|29.0|379/439|GDI| RP:SCP:NREP 2 RP:SCP:REP 10->48|1kdgA1|2e-04|33.3|39/360|c.3.1.2| RP:SCP:REP 349->465|1ltxR2|1e-11|18.8|101/107|d.16.1.6| HM:SCP:REP 9->422|1ltxR1|2.1e-30|26.0|362/501|c.3.1.3|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 222 OP:NHOMOORG 147 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---111-------121111111121211111111221121111111112222121211211122222212222212222222222222-122121222221-1221-1113----1---1---132-1-362-212--1-1--3-1111-111112-1111-121-22221--111------12-2---21--1-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 282 STR:RPRED 53.0 SQ:SECSTR #######TEEEccEEEEcccHHHHHHHHHHHTTTccEEEEccccGGGcGccEEEEEccccEEccTTTcHHHcccccTTcHGGGccTTEEcccccHHGGccEEcccccEEcccHHHHHHHHHTGGGGccEEEccEEEEEETTTEEEETEEEE####EEEccccTGGGTTcccccHHHHHHHHHHHHHH#HHTTTccGGGTTTcccccHHHHHHTccccHHHHHHHHHTTccccTTTccHHHHHHHHHHHHHHHHTTcccc##ccEEEETTcTTHHHHHHHHHHHHTTcEEETTccEE############################################################################################################################################################################################################################################ PSIPRED ccccccccHHHEEEEEEccccHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccEEEcccEEEEcccHHHHHHHHccccEEEEEEEEccEEEEEccccccccccccccccEEEccccHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHccccccEEEccccccHHHHHHHHHHHHccEEEEccccccEEEccccEEEcccccEEEEEEccccEEEccEEEEcHHHccccccccccccccEEEEEEEEEcccHHHHccccccccccccEEEEEEcccccccccccccccEEEEEEcccccccccccEEEEEEEccccccHHHHHHHHHHHHccccccccEEEEEEEEEEccccccccccccccccccccEEEEccccccccccHHHHHHHHHHHHHHcccccccHHHEEccccccccccccccc //