[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_02988
DDBJ      :             
Swiss-Prot:RL39_DEBHA   RecName: Full=60S ribosomal protein L39;

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
a.137.1
:51 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->50 2zkr3 PDBj 4e-19 75.0 %
:HMM:SCOP  3->51 1ffkY_ a.137.1.1 * 2.5e-16 59.2 %
:RPS:PFM   10->49 PF00832 * Ribosomal_L39 1e-06 80.0 %
:HMM:PFM   9->50 PF00832 * Ribosomal_L39 2.4e-25 61.9 42/43  
:BLT:SWISS 1->51 RL39_DEBHA 7e-25 90.2 %

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_02991 GT:GENE CIRG_02988 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 51 SQ:AASEQ MPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI SW:ID RL39_DEBHA SW:DE RecName: Full=60S ribosomal protein L39; SW:GN Name=RPL39; OrderedLocusNames=DEHA2G15422g; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->51|RL39_DEBHA|7e-25|90.2|51/51| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 3->50|2zkr3|4e-19|75.0|48/48| RP:PFM:NREP 1 RP:PFM:REP 10->49|PF00832|1e-06|80.0|40/43|Ribosomal_L39| HM:PFM:NREP 1 HM:PFM:REP 9->50|PF00832|2.4e-25|61.9|42/43|Ribosomal_L39| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00832|IPR000077| GO:PFM GO:0005622|"GO:intracellular"|PF00832|IPR000077| GO:PFM GO:0005840|"GO:ribosome"|PF00832|IPR000077| GO:PFM GO:0006412|"GO:translation"|PF00832|IPR000077| HM:SCP:REP 3->51|1ffkY_|2.5e-16|59.2|49/49|a.137.1.1|1/1|Ribosomal protein L39e| OP:NHOMO 212 OP:NHOMOORG 144 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 1--1111---1-1111111--1111--111---11-1111211---1111111-111111111-11---11--11-1----111--11-121111111111--324-11---1-11-1122-2149182665-332-1---1-41-111111---21111-1111--11-11111111111111133261331111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 48 STR:RPRED 94.1 SQ:SECSTR ##ccccHHHHHHHHHHHHHTccccHHHHHHHccccTTGGGcccTTTcccc# DISOP:02AL 50-52| PSIPRED ccccHHHHHHHHHHHHHHHccccccEEEEccccEEEEcccccccccccccc //