[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Coccidioides immitis RMSCC 2394 (cimm2)
Gene : CIRG_10403
DDBJ      :             
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  574/915 : Eukaryota  22/199 : Viruses  0/175   --->[See Alignment]
a.4.5b.82.3
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->221 3d0sA PDBj 8e-62 57.6 %
:RPS:PDB   6->220 3e5uC PDBj 3e-35 15.6 %
:RPS:SCOP  6->140 2h6bA2  b.82.3.2 * 6e-21 15.9 %
:RPS:SCOP  143->221 2gauA1  a.4.5.4 * 3e-10 33.3 %
:HMM:SCOP  3->141 2gauA2 b.82.3.2 * 9.7e-34 43.2 %
:HMM:SCOP  142->223 2gauA1 a.4.5.4 * 1.7e-19 37.0 %
:RPS:PFM   29->111 PF00027 * cNMP_binding 2e-21 50.6 %
:RPS:PFM   132->208 PF04492 * Phage_rep_O 4e-04 31.4 %
:HMM:PFM   27->114 PF00027 * cNMP_binding 6.3e-29 44.3 88/91  
:HMM:PFM   171->207 PF00392 * GntR 1.6e-07 32.4 37/64  
:BLT:SWISS 34->210 CRP_HAEIN 3e-21 31.4 %
:PROS 75->92|PS00889|CNMP_BINDING_2
:SEG

SeqInfo AminoSeq See neighboring genes
Abbreviations Back to title page
GT:ID CIRT_10408 GT:GENE CIRG_10403 GT:PRODUCT GT:DATABASE Broad_Institute GT:ORG cimm2 LENGTH 221 SQ:AASEQ MDNDAPLFSALDDESMTALHASMAESKLRRGEVLFHEGDSGDKLYVVIDGKVKLGRTSSDGRENLLAIMGPGQMFGELSLFDPGPRSATVTAVTDSAFASLSHEDLLKWLEGRPVVARGLLAQLAGRLRKANDVVADLVFSDVPGRVAKALLDLADRFGRTADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVIMDIERMARRAR BL:SWS:NREP 1 BL:SWS:REP 34->210|CRP_HAEIN|3e-21|31.4|175/224| PROS 75->92|PS00889|CNMP_BINDING_2|PDOC00691| SEG 117->131|argllaqlagrlrka| BL:PDB:NREP 1 BL:PDB:REP 5->221|3d0sA|8e-62|57.6|217/224| RP:PDB:NREP 1 RP:PDB:REP 6->220|3e5uC|3e-35|15.6|212/219| RP:PFM:NREP 2 RP:PFM:REP 29->111|PF00027|2e-21|50.6|83/90|cNMP_binding| RP:PFM:REP 132->208|PF04492|4e-04|31.4|70/97|Phage_rep_O| HM:PFM:NREP 2 HM:PFM:REP 27->114|PF00027|6.3e-29|44.3|88/91|cNMP_binding| HM:PFM:REP 171->207|PF00392|1.6e-07|32.4|37/64|GntR| GO:PFM:NREP 1 GO:PFM GO:0006260|"GO:DNA replication"|PF04492|IPR006497| RP:SCP:NREP 2 RP:SCP:REP 6->140|2h6bA2|6e-21|15.9|132/145|b.82.3.2| RP:SCP:REP 143->221|2gauA1|3e-10|33.3|78/81|a.4.5.4| HM:SCP:REP 3->141|2gauA2|9.7e-34|43.2|139/0|b.82.3.2|1/1|cAMP-binding domain-like| HM:SCP:REP 142->223|2gauA1|1.7e-19|37.0|81/0|a.4.5.4|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 1050 OP:NHOMOORG 596 OP:PATTERN -------------------------------------------------------------------- 147-411111111123223-32111233333111111111132411222---111111--534161131111111111----512212-----111---1-3211213-1----------------1-------1-544331-13-73352224422111112343264541211111211-12311111--11111111-11111111-12211111-341-12------211--------------------1111111--111--11111121-11-------------------------------------------2-231333333332311----443-11-11--238843--3111112----12--113------266722-4444522212222222-121--5122-2--11-1-2---2211---2-12222112--------1----73--------------------------------131-1----211112232321131333323121224---44144-222151121-31--131-------1--43466321211-35112-32332221211-15733--------------------1----221112112-1-111111111111121111121--2313------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11---------123-11111111111111112222211---3222122333211113222---------11111111111111111111111111111--2-332244--------212--------------------------2-1-------1- 1-11-----------1-----------------------1-----------------1--------1-1--1---1--------------------------------1------------------------------------------------------1------4------1-4-1--1--------312-14 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 99.1 SQ:SECSTR ##TccccccccccGGGGGGGGGcEEEEEcTTcEEEcTTcccccEEEEEEccEEEEEEcTTccEEEEEEEcTTcEEcccccccccccEEEEEEcccEEEEEEcHHHHHHHHHHcTHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHcEEETTEEEEcccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEccccEEEccHHHHHHHHH PSIPRED cccccHHHccccHHHHHHHHHHcEEEEEccccEEEcccccccEEEEEEEEEEEEEEEcccccEEEEEEEccccEEEEHHHHccccEEEEEEEEccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccEEEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccEEEEEcHHHHHHHcc //