[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0024
DDBJ      :CPE0024      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:386 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   33->251 2vkhC PDBj 1e-04 29.1 %
:BLT:PDB   231->308 1dzbA PDBj 6e-04 33.8 %
:RPS:SCOP  263->386 1zatA1  b.160.1.1 * 4e-26 20.5 %
:HMM:SCOP  260->386 1zatA1 b.160.1.1 * 7.9e-27 35.0 %
:RPS:PFM   266->384 PF03734 * YkuD 3e-07 43.4 %
:HMM:PFM   264->385 PF03734 * YkuD 1.4e-24 30.6 108/116  
:BLT:SWISS 28->270 Y147_TNAVC 2e-05 26.6 %
:BLT:SWISS 266->385 ERFK_ECOLI 4e-07 35.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79730.1 GT:GENE CPE0024 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(36054..37214) GB:FROM 36054 GB:TO 37214 GB:DIRECTION - GB:GENE CPE0024 GB:PRODUCT conserved hypothetical protein GB:NOTE 386 aa, C-terminal portion is similar to pir:A69760 conserved hypothetical protein yciB from Bacillus subtilis (194 aa); 33.9% identity in 165 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB79730.1 LENGTH 386 SQ:AASEQ MKNKKLLISISSTILILLIIIVAYFILSFSNNLNKFKEDLALNNYEAASNCFNNGTKNIILRKTFLKSSDSVIIEKLSEIENDYYSGDISEEETVEDLNGLLSLNTSNEEILNFKNTLPLIKDSKDSFDIGISKLDEENYLEALNYFKSVHNLSDCKAQALEYEETCLDKIREPILETVDEYISNEKYSKGIEYLDSKINSLPDDPKLQKKRDELENLRLEHLEDYSQKNIDKATARTAPVMEYYKKLNEDTINQFDITSNTNYLVFVNIAEQKTYVYEGSKNDWTLDKTFTCSTGIEGKETPVGVFTVQNRAPWFFSPKYGQGGKYYVQFMGNYLFHSIPFDSDKTTVSDPTLGVPSSHGCIRLSVEDSKWLYDNVQNGSKIIIY GT:EXON 1|1-386:0| BL:SWS:NREP 2 BL:SWS:REP 28->270|Y147_TNAVC|2e-05|26.6|214/1481| BL:SWS:REP 266->385|ERFK_ECOLI|4e-07|35.0|117/310| TM:NTM 1 TM:REGION 7->29| SEG 6->21|llisisstililliii| BL:PDB:NREP 2 BL:PDB:REP 33->251|2vkhC|1e-04|29.1|196/537| BL:PDB:REP 231->308|1dzbA|6e-04|33.8|74/222| RP:PFM:NREP 1 RP:PFM:REP 266->384|PF03734|3e-07|43.4|106/136|YkuD| HM:PFM:NREP 1 HM:PFM:REP 264->385|PF03734|1.4e-24|30.6|108/116|YkuD| RP:SCP:NREP 1 RP:SCP:REP 263->386|1zatA1|4e-26|20.5|117/126|b.160.1.1| HM:SCP:REP 260->386|1zatA1|7.9e-27|35.0|120/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 64 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------111--1------------------------------------------------------------------------------------------------------------------------------------1-----------------1---------------------21-111121-331111111--1---111-1-1-------------------------------------1--321111111212-1--2221-1----11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 65.5 SQ:SECSTR ################################HHHHHHHHHHHHHHHHHTccEEcccEEEEEcccccccHHHHHHHHHHHcTTc######EEEEEEcTTcTT#HHHHHHHHHHHHHHHTTccTTcccccccHHHHHHHHH##HHHHHHHHHHHHHHHHHHHHcTTccHHHH#######HHHHHHHH#HcccHHHHHHHHHHHHETTTccccccH#HHHHH#####HHHHHHTcccHHHHHHHHHHHHHHHHEEEEEETTTTEEEEEEccccGGGcEEEEEEEccTTTccEEEEccccccEEEccEEEc############################################################################## DISOP:02AL 1-4, 206-217, 246-256| PSIPRED ccccEEEEEEHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHcccccEEEEEEEEcccccHHHHHHHccccccEEEEEcHHHHHHHHccccEEccccHHHHHHHHHHccHHccccEEEEEccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccccccccccccHHHHcccccccccccccccccEEEEEEccccEEEEEEccccEEEEEEEEEEEEcccccccccEEEEEEEcccccccccccccccccccccccEEEEEccccccccccccccccccccccEEEccHHHHHHHHHHcccccEEEEc //