[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0029
DDBJ      :CPE0029      probable transcription regulator
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  173/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.121.1a.4.1
:189 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->167 2eh3A PDBj 2e-13 33.6 %
:RPS:PDB   3->186 1a6iA PDBj 3e-29 13.3 %
:RPS:SCOP  3->78 2fbqA1  a.4.1.9 * 8e-16 27.6 %
:RPS:SCOP  76->186 2genA2  a.121.1.1 * 1e-13 11.7 %
:HMM:SCOP  2->80 1t33A1 a.4.1.9 * 2.4e-16 39.7 %
:HMM:SCOP  75->189 1vi0A2 a.121.1.1 * 3.2e-18 27.8 %
:RPS:PFM   8->50 PF00440 * TetR_N 2e-07 46.5 %
:RPS:PFM   54->155 PF08359 * TetR_C_4 1e-05 37.6 %
:HMM:PFM   8->52 PF00440 * TetR_N 1.3e-18 51.1 45/47  
:HMM:PFM   57->153 PF08362 * TetR_C_3 0.00011 21.9 96/143  
:BLT:SWISS 8->186 FADR_BACSU 1e-13 29.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79735.1 GT:GENE CPE0029 GT:PRODUCT probable transcription regulator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 42348..42917 GB:FROM 42348 GB:TO 42917 GB:DIRECTION + GB:GENE CPE0029 GB:PRODUCT probable transcription regulator GB:NOTE 189 aa, similar to pir:S38906 hypothetical protein 4 from Clostridium pasteurianum (190 aa); 45.7% identity in 186 aa overlap TetR/AcrR family GB:PROTEIN_ID BAB79735.1 LENGTH 189 SQ:AASEQ MNRTKKAIFEAAINVFATSGYNGSTVDEIASKANVAKGTLYYNFKSKEEIFNFVISKGLEIWHEKLTDIENLEDEPIEKLKKLFKMQFELLYENRAFFKMVMSQLWGKETRQDELRNKITEYIEGIERILKEAISKKQIRECDISLLAHSLFGSLISTSLYELSRDKEFNVNKVIDEITINILDGIVIK GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 8->186|FADR_BACSU|1e-13|29.9|174/194| BL:PDB:NREP 1 BL:PDB:REP 4->167|2eh3A|2e-13|33.6|149/170| RP:PDB:NREP 1 RP:PDB:REP 3->186|1a6iA|3e-29|13.3|180/193| RP:PFM:NREP 2 RP:PFM:REP 8->50|PF00440|2e-07|46.5|43/47|TetR_N| RP:PFM:REP 54->155|PF08359|1e-05|37.6|93/132|TetR_C_4| HM:PFM:NREP 2 HM:PFM:REP 8->52|PF00440|1.3e-18|51.1|45/47|TetR_N| HM:PFM:REP 57->153|PF08362|0.00011|21.9|96/143|TetR_C_3| GO:PFM:NREP 2 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00440|IPR001647| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00440|IPR001647| RP:SCP:NREP 2 RP:SCP:REP 3->78|2fbqA1|8e-16|27.6|76/79|a.4.1.9| RP:SCP:REP 76->186|2genA2|1e-13|11.7|111/118|a.121.1.1| HM:SCP:REP 2->80|1t33A1|2.4e-16|39.7|78/0|a.4.1.9|1/1|Homeodomain-like| HM:SCP:REP 75->189|1vi0A2|3.2e-18|27.8|115/0|a.121.1.1|1/1|Tetracyclin repressor-like, C-terminal domain| OP:NHOMO 312 OP:NHOMOORG 179 OP:PATTERN --------------------------------1-----------1-----1--------1-------- --------------1------1--1-------31211-1---------------1--1----1--11211-------------1---1--------------------11------------------------2----11------1---------------1--11-1----------------11---13255555556555444512554455532312--------22------------------------11---------1-------------------------------------------------------2132-------1-1-122-111-1------1----121532---111---2--11------1-1-----1--2-111-1-11111-11-11-1-11--133111111111-----1--211211-------------------------------------------------1-1--------1---------11--------11-1--------2--1-11-------------------------5-21-------------11--------1--4------------------------------1-11-1------------1---------------------------1---------------------------------------------------------1---------------------1-----------2----------------------------1----11-------1111------------------------------------------11--------------------------------------------1----1-1- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 98.4 SQ:SECSTR #cccHHHHHHHHHHHHHHHTTTcccHHHHHHHHTccHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccTTHHHHHHHHccccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHH## DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccc //