[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0039
DDBJ      :CPE0039      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  184/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->295 PF03773 * DUF318 4e-26 32.1 %
:HMM:PFM   4->295 PF03773 * DUF318 5.1e-65 28.3 290/307  
:BLT:SWISS 10->296 YCGR_BACSU 3e-43 32.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79745.1 GT:GENE CPE0039 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 51507..52400 GB:FROM 51507 GB:TO 52400 GB:DIRECTION + GB:GENE CPE0039 GB:PRODUCT conserved hypothetical protein GB:NOTE 297 aa, similar to gpu:AP001512_105 BH1518 gene product from Bacillus halodurans (337 aa); 39.6% identity in 283 aa overlap. Putative N-terminal signal sequence and 5 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB79745.1 LENGTH 297 SQ:AASEQ MELLNKFSIVFSSIVIEALPFILIGAVLASFMQVYISNNIFNKIISKNKLLGSIEAGIIGVFLPVCECATVPITKGLLNKKVPLNVAITYMLAAPIVNPLVILSTYYAFDGNIKVVLLRVGVGFSIAVIAGLLMLCLSGENNIFIDNGEGELQGKCLCGCSEIDDNSSKLIRLLKHTSLEFYEIGKYFIVGATLAAIFQTFVPRDIIFYFENSAVLSIIILMAFSFLISLCSEADAFVASTFMNRFSLGSITGFLIIGPMIDLKNTIMLFSIFKKSFVIKLLFVVFSLCFIASALIF GT:EXON 1|1-297:0| BL:SWS:NREP 1 BL:SWS:REP 10->296|YCGR_BACSU|3e-43|32.1|280/294| TM:NTM 8 TM:REGION 8->30| TM:REGION 49->71| TM:REGION 83->105| TM:REGION 115->137| TM:REGION 179->201| TM:REGION 217->239| TM:REGION 248->270| TM:REGION 276->297| SEG 36->49|isnnifnkiisknk| RP:PFM:NREP 1 RP:PFM:REP 10->295|PF03773|4e-26|32.1|280/292|DUF318| HM:PFM:NREP 1 HM:PFM:REP 4->295|PF03773|5.1e-65|28.3|290/307|DUF318| OP:NHOMO 226 OP:NHOMOORG 190 OP:PATTERN -------------------------------------12------1-11--1---------------- ------1-------1---------------------1------------11----------1-1--12-------1--------------1--1-------------------------------11-11111112111-----1-112121111111111-1111-1211-1-----1---------------222222311213221-122-122111-----11111111----------------11111-------------------------1112111111111111111111111111111111111111111212-13-------1-111111111-1------2-111----1-1---1--------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1-11----1-31--2--111111---------31---------1----------1--1--------1----------2-----------1-----------------------------------1----------------------------------------------------------------------------------------------------------------------1-------------121---------------------------1---------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 155-163| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //