[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0041
DDBJ      :CPE0041      probable prolipoprotein diacylglyceryl transferase
Swiss-Prot:LGT1_CLOPE   RecName: Full=Prolipoprotein diacylglyceryl transferase 1;         EC=2.4.99.-;

Homologs  Archaea  0/68 : Bacteria  414/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:262 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   3->235 PF01790 * LGT 8e-31 36.7 %
:HMM:PFM   1->248 PF01790 * LGT 2.8e-85 42.3 248/257  
:BLT:SWISS 1->262 LGT1_CLOPE e-128 100.0 %
:PROS 128->140|PS01311|LGT
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79747.1 GT:GENE CPE0041 GT:PRODUCT probable prolipoprotein diacylglyceryl transferase GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 53398..54186 GB:FROM 53398 GB:TO 54186 GB:DIRECTION + GB:GENE CPE0041 GB:PRODUCT probable prolipoprotein diacylglyceryl transferase GB:NOTE 262 aa, similar to sp:LGT_BACSU PROLIPOPROTEIN DIACYLGLYCERYL TRANSFERASE (EC 2.4.99.-) (SPORE GERMINATION PROTEIN GERF) from Bacillus subtilis (269 aa); 39.3% identity in 257 aa overlap. 7 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB79747.1 LENGTH 262 SQ:AASEQ MNPVAFSIGSFEVRWYGIIIALGILIAMTLVSINAKKKNLNFDVILDLFLWCFPFAIIGARAYYVLFELENYHSFWDMINIRQGGLAIHGGIIGAFLTAFIYCKVKKVDFLAYADIVAPAFILAQGIGRWGNFFNQEAHGGQVTSEFISKFPEFIQRGMYINGAYYHPTFLYESIWDIFVAILLMIILYNITDRYKGVVISAYISLYSLGRFFIEGLRTDSLYFMNIRVAQLVSLLGIIIGIVAIIIIVSRGKKKRKGIFIN GT:EXON 1|1-262:0| SW:ID LGT1_CLOPE SW:DE RecName: Full=Prolipoprotein diacylglyceryl transferase 1; EC=2.4.99.-; SW:GN Name=lgt1; OrderedLocusNames=CPE0041; SW:KW Cell membrane; Complete proteome; Membrane; Transferase;Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->262|LGT1_CLOPE|e-128|100.0|262/262| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| PROS 128->140|PS01311|LGT|PDOC01015| TM:NTM 7 TM:REGION 8->30| TM:REGION 41->63| TM:REGION 83->104| TM:REGION 108->130| TM:REGION 173->194| TM:REGION 196->218| TM:REGION 229->250| SEG 17->27|giiialgilia| SEG 84->95|gglaihggiiga| SEG 237->249|giiigivaiiiiv| RP:PFM:NREP 1 RP:PFM:REP 3->235|PF01790|8e-31|36.7|229/251|LGT| HM:PFM:NREP 1 HM:PFM:REP 1->248|PF01790|2.8e-85|42.3|248/257|LGT| GO:PFM:NREP 4 GO:PFM GO:0009249|"GO:protein lipoylation"|PF01790|IPR001640| GO:PFM GO:0016020|"GO:membrane"|PF01790|IPR001640| GO:PFM GO:0016757|"GO:transferase activity, transferring glycosyl groups"|PF01790|IPR001640| GO:PFM GO:0042158|"GO:lipoprotein biosynthetic process"|PF01790|IPR001640| OP:NHOMO 442 OP:NHOMOORG 414 OP:PATTERN -------------------------------------------------------------------- -1--211111111111111-11111111111-11211112-1111111111121211111-111111121111111111---1--------11--------------------------------1----------12222---1-1111111221111111111111111111111111111--1--11-1111111112111121111111111111111111111111111111111111111111111111111111111111111111---12111111111111111111111111111111111111111111111122141111111111111112221-1111121-21121-121----111-------------------------------------------------1---------------------------11111111----------111111----111111111-11----------------------------------------------------------------1------------------1-----11----11111--111-------1-111111111111111111111111---11-11-1-1-1--------111--1--------1-------------------------------------------------------------------------------1---------------1-----1111-1------1----------1-----------1----1111-11111111--------------------------------------11------------------1------11-11-1111--1-11---1111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 256-257| PSIPRED cccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //