[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0057
DDBJ      :CPE0057      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  457/915 : Eukaryota  120/199 : Viruses  0/175   --->[See Alignment]
c.111.1
:253 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   42->152 1zud3 PDBj 2e-11 33.6 %
:RPS:PDB   1->176 3cmmA PDBj 5e-31 22.2 %
:RPS:SCOP  6->170 1jw9B  c.111.1.1 * 1e-30 25.6 %
:HMM:SCOP  6->254 1yovB1 c.111.1.2 * 3e-62 32.1 %
:RPS:PFM   42->151 PF00899 * ThiF 8e-17 42.2 %
:HMM:PFM   23->151 PF00899 * ThiF 1.1e-45 50.8 128/136  
:HMM:PFM   113->196 PF05097 * DUF688 0.00053 25.3 83/448  
:BLT:SWISS 9->175 YGDL_ECOLI 2e-31 39.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79763.1 GT:GENE CPE0057 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 68347..69108 GB:FROM 68347 GB:TO 69108 GB:DIRECTION + GB:GENE CPE0057 GB:PRODUCT conserved hypothetical protein GB:NOTE 253 aa, similar to gpu:AP001511_144 BH1255 gene product from Bacillus halodurans (259 aa); 37.4% identity in 246 aa overlap. 2 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB79763.1 LENGTH 253 SQ:AASEQ MLQHSLSRTELLIGKDALDKLAKSKVMVFGVGGVGSFTVEALARAGVGNLILVDDDTVCLTNLNRQIHATYKTISKNKVEVMKERVLSVNRNCNVETIQVFVTPDNLEEIIPDDVDYVVDAIDTVSAKIALAVYCEQKGIKLMSSMGTGNKLNPAEFKVADIYNTKVCPLAKVMRYELRKRGVKKLKVVYSEEMPRKPKVEDVVTCKTGCVCTGGTKKCSAKRQIPGSVSFVPPVAGMIIASEVVKDLIKEYI GT:EXON 1|1-253:0| BL:SWS:NREP 1 BL:SWS:REP 9->175|YGDL_ECOLI|2e-31|39.5|167/268| SEG 26->35|vmvfgvggvg| SEG 178->189|lrkrgvkklkvv| SEG 203->219|vvtcktgcvctggtkkc| BL:PDB:NREP 1 BL:PDB:REP 42->152|1zud3|2e-11|33.6|110/240| RP:PDB:NREP 1 RP:PDB:REP 1->176|3cmmA|5e-31|22.2|176/1001| RP:PFM:NREP 1 RP:PFM:REP 42->151|PF00899|8e-17|42.2|109/135|ThiF| HM:PFM:NREP 2 HM:PFM:REP 23->151|PF00899|1.1e-45|50.8|128/136|ThiF| HM:PFM:REP 113->196|PF05097|0.00053|25.3|83/448|DUF688| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF00899|IPR000594| RP:SCP:NREP 1 RP:SCP:REP 6->170|1jw9B|1e-30|25.6|164/240|c.111.1.1| HM:SCP:REP 6->254|1yovB1|3e-62|32.1|246/0|c.111.1.2|1/1|Activating enzymes of the ubiquitin-like proteins| OP:NHOMO 756 OP:NHOMOORG 598 OP:PATTERN --1---1---------11---------1--1-111------1--11---111---11-1-11-----1 -----------1-1----------------------------------------------------------------1112--1---11211111---1111------1----------------11---111-------------------------------------------1---1------11--111111121211211121111111111111-11------2111111111111111112211---------------------1------------------------------------------------22122222222212111112111211-1-111-111221-1123214-11-----------------------------------1-11-1--1--1---------------------------------------------11111111---------------------1-----111111111111111111111111111111111121111111-1112111111211111111111--11111-2-2-1----1--134313223211112---1-1112212211-11111111--1111111211111111111111111112111111--1-1-1------21121212222222222-2222221222222222221111112122111111221111111111222211-111111111111---1--------1--111222212122222112222222211111111111111111111111-1--11--13222222221111111222222231111-11---------------1---------------------------------1----11 ----111-1111211-111111111111111111111111111111111111111-1-111111111111111112212211111111-11111111111111121--1----------------------------------------------------------------1--2227221111--11112321122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 177 STR:RPRED 70.0 SQ:SECSTR ccccTTHHHHHHHcHHHHHHHHTcEEEEEcccHHHHHHHHHHHHcTTcEEEEEccccccGGGTTTcTTccGGGTTccHHHHHHHHHHHHcGGGTTTEEEEcccccGGGTTTccHccEEEEccccHHHHHHHHHHHHHHTccEEEEEEETTEEEEEEEcTTTcccGGGcccccccccG############################################################################ PSIPRED ccHHHHccEEHHccHHHHHHHHHccEEEEcccHHHHHHHHHHHHHcccEEEEEEccEEcHHHHcccccccHHHcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHccccEEEEEcccEEEEEEEEEEEcccccccccHHHHHHHHcccccccccccEEcccccccccccccccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccc //