[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0073
DDBJ      :CPE0073      probable transcription antiterminator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  186/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.142.1b.35.2
:194 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   10->60 1auuA PDBj 3e-06 42.0 %
:BLT:PDB   83->165 1tlvA PDBj 3e-13 39.8 %
:RPS:PDB   11->63 1auuA PDBj 4e-12 40.4 %
:RPS:SCOP  11->61 1auuA  b.35.2.1 * 2e-12 42.0 %
:RPS:SCOP  64->166 1h99A1  a.142.1.1 * 5e-18 33.0 %
:HMM:SCOP  9->64 1auuA_ b.35.2.1 * 7.7e-13 45.5 %
:HMM:SCOP  62->176 1h99A1 a.142.1.1 * 1.7e-25 36.5 %
:RPS:PFM   11->61 PF03123 * CAT_RBD 3e-05 46.0 %
:RPS:PFM   83->165 PF00874 * PRD 4e-12 39.8 %
:HMM:PFM   83->165 PF00874 * PRD 1.9e-24 42.2 83/90  
:HMM:PFM   9->67 PF03123 * CAT_RBD 3e-17 44.8 58/59  
:BLT:SWISS 10->179 SACY_BACSU 2e-29 37.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79779.1 GT:GENE CPE0073 GT:PRODUCT probable transcription antiterminator GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 101425..102009 GB:FROM 101425 GB:TO 102009 GB:DIRECTION + GB:GENE CPE0073 GB:PRODUCT probable transcription antiterminator GB:NOTE 194 aa, similar to pir|D69632 transcription antiterminator glcT from Bacillus subtilis (285 aa); 35.5% identity in 169 aa overlap. Probably truncated by frameshift mutation GB:PROTEIN_ID BAB79779.1 LENGTH 194 SQ:AASEQ MIKKTEKAYEVKRSFNNNIVLVDDDEKEIILFAKGIGFNCKKGSIIPENTNIEKIFTIQDENNIANFRRVVGSNDEKFIAFCEELILEISRDFSDELNEIIHIGLIDHISFAIERMKKGEILRNPFLVEIETLYPKEFEAATKMVKKLEDFTGVSIVDDEIGFIAYAYTFGKNNRKDFSYNKIYLYSKYCCRIY GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 10->179|SACY_BACSU|2e-29|37.3|169/280| BL:PDB:NREP 2 BL:PDB:REP 10->60|1auuA|3e-06|42.0|50/55| BL:PDB:REP 83->165|1tlvA|3e-13|39.8|83/204| RP:PDB:NREP 1 RP:PDB:REP 11->63|1auuA|4e-12|40.4|52/55| RP:PFM:NREP 2 RP:PFM:REP 11->61|PF03123|3e-05|46.0|50/58|CAT_RBD| RP:PFM:REP 83->165|PF00874|4e-12|39.8|83/90|PRD| HM:PFM:NREP 2 HM:PFM:REP 83->165|PF00874|1.9e-24|42.2|83/90|PRD| HM:PFM:REP 9->67|PF03123|3e-17|44.8|58/59|CAT_RBD| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF03123|IPR004341| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF03123|IPR004341| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00874|IPR011608| RP:SCP:NREP 2 RP:SCP:REP 11->61|1auuA|2e-12|42.0|50/55|b.35.2.1| RP:SCP:REP 64->166|1h99A1|5e-18|33.0|103/115|a.142.1.1| HM:SCP:REP 9->64|1auuA_|7.7e-13|45.5|55/0|b.35.2.1|1/1|SacY-like RNA-binding domain| HM:SCP:REP 62->176|1h99A1|1.7e-25|36.5|115/115|a.142.1.1|1/1|PTS-regulatory domain, PRD| OP:NHOMO 305 OP:NHOMOORG 186 OP:PATTERN -------------------------------------------------------------------- ----------1-1----------------------------------------11----------------1---111------------------------------------------------------------------------------------------------------------------23111111122111111335554211121-113122313111111111111111111111123--33--2-213--14---21-11-11221112-1122221111-11111111111111211---1112-1-544445335232-B--1111-----1-------1------221-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------132-2-1--2122211--1111221---2-11111112134111----------------1-1-1111--1--------------------------------1----------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 137 STR:RPRED 70.6 SQ:SECSTR #########EEcccccccEEEEEccccEEEEEcTTccTTccTTccccTTTTccEEEEcccccc###################HHHHHHHHHHHcccccTHHHHHHHHHHHHHHHHHHTTcccccTTHHHHHHHcHHHHHHHHHHHHHHHHHHcccccHHHHHHHH############################# DISOP:02AL 1-5| PSIPRED ccccccccEEEEEEEcccEEEEEccccEEEEEEccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccHHHHHHHEEHHHHccc //