[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0075
DDBJ      :CPE0075      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  361/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.84.3
:85 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->84 1glaF PDBj 1e-19 56.2 %
:RPS:PDB   16->82 3csqA PDBj 5e-09 10.4 %
:RPS:SCOP  21->84 1f3gA  b.84.3.1 * 2e-12 56.2 %
:HMM:SCOP  21->84 2gprA_ b.84.3.1 * 2.5e-21 54.7 %
:RPS:PFM   22->84 PF00358 * PTS_EIIA_1 8e-17 55.6 %
:HMM:PFM   21->83 PF00358 * PTS_EIIA_1 7.1e-26 54.0 63/133  
:BLT:SWISS 21->84 PTGA_SALTY 3e-19 57.8 %
:PROS 62->74|PS00371|PTS_EIIA_TYPE_1_HIS

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79781.1 GT:GENE CPE0075 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(102497..102754) GB:FROM 102497 GB:TO 102754 GB:DIRECTION - GB:GENE CPE0075 GB:PRODUCT hypothetical protein GB:NOTE 85 aa, no significant homology. GB:PROTEIN_ID BAB79781.1 LENGTH 85 SQ:AASEQ MLLQLEKLLIYHKYQIKFSLEKMAGDGVAIEVTGDTIVAPADGELSLVFKTNHAFAMTLSNGIELLVHVGIDTVSLEGEGFERLT GT:EXON 1|1-85:0| BL:SWS:NREP 1 BL:SWS:REP 21->84|PTGA_SALTY|3e-19|57.8|64/169| PROS 62->74|PS00371|PTS_EIIA_TYPE_1_HIS|PDOC00528| BL:PDB:NREP 1 BL:PDB:REP 21->84|1glaF|1e-19|56.2|64/161| RP:PDB:NREP 1 RP:PDB:REP 16->82|3csqA|5e-09|10.4|67/324| RP:PFM:NREP 1 RP:PFM:REP 22->84|PF00358|8e-17|55.6|63/132|PTS_EIIA_1| HM:PFM:NREP 1 HM:PFM:REP 21->83|PF00358|7.1e-26|54.0|63/133|PTS_EIIA_1| GO:PFM:NREP 4 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00358|IPR001127| GO:PFM GO:0006810|"GO:transport"|PF00358|IPR001127| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00358|IPR001127| GO:PFM GO:0016020|"GO:membrane"|PF00358|IPR001127| RP:SCP:NREP 1 RP:SCP:REP 21->84|1f3gA|2e-12|56.2|64/150|b.84.3.1| HM:SCP:REP 21->84|2gprA_|2.5e-21|54.7|64/0|b.84.3.1|1/1|Duplicated hybrid motif| OP:NHOMO 851 OP:NHOMOORG 362 OP:PATTERN -------------------------------------------------------------------- -----211113-1----------------------------------------1---------2-------1---111----1-----------------------------------------------------------------------------------------------------1-----1-232222222332222223455443222121235244425112444444444444443222279-263-263599225832433111244453334444444444443444444444444444443324444---5A6667757161-A11211111-1-212-----1------211--12----22---------------------------------------------------------------------------------------------------------------------1--------1111111----1111------111--1-----1------------------2----------------------------------------------------------------------1--111-------11111111111111111111-------11-11122322422222222222-2222222222222222222343333232222222222222222222222222-322222222222--1---------------111211111111111------------11111212-------------------11111111111111-----------------2------11111111-------1---1-2-----111-11---------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 82 STR:RPRED 96.5 SQ:SECSTR ##EEEEEEEETTTEEcTTTcTTcccEEEcccccccEEEccccEEEEEEETTTTEEEEEEcccEEcTTccEEcEEEEEEccccEc# DISOP:02AL 1-2, 83-85| PSIPRED cEEEEHHcccHHHcccHHHccccccccEEEEEcccEEEEEEEEEEEEEEccccEEEEEEccccEEEEEccEEEEEEccccccccc //