[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0094
DDBJ      :CPE0094      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  330/915 : Eukaryota  65/199 : Viruses  0/175   --->[See Alignment]
:252 amino acids
:PSIPRED
:RPS:PFM   18->244 PF01226 * Form_Nir_trans 2e-34 38.8 %
:HMM:PFM   12->248 PF01226 * Form_Nir_trans 1.1e-63 32.9 237/250  
:BLT:SWISS 24->244 NIRC_SHIFL 3e-35 32.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79800.1 GT:GENE CPE0094 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 130202..130960 GB:FROM 130202 GB:TO 130960 GB:DIRECTION + GB:GENE CPE0094 GB:PRODUCT conserved hypothetical protein GB:NOTE 252 aa, similar to sp:YWCJ_BACSU HYPOTHETICAL 28.4 KDA PROTEIN IN SACT-SACP INTERGENIC REGION from Bacillus subtilis (256 aa); 35.1% identity in 242 aa overlap. 6 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB79800.1 LENGTH 252 SQ:AASEQ MQKKDINLISDMAVNKFKFADRAPIKYFLRAVVAGFFLVVAIILSYTTGAVLNNSYPEMARIMVAATFSLALGLIAFIGGELFTGNNLVMAIGIYNNECTLTMALKVWFMSYLGNFIGSILLGFLFVKSGASMDLIKDYAKGIVDIKLNLPALELFLRGMLCNFMVCIAFLSTIKMKSETGKLIIMFWCIFAFVIAGFEHSIANMGIFSITYFASGDVSLPLVFRNLFWVTLGNMVGGGVLLALPLKFMSME GT:EXON 1|1-252:0| BL:SWS:NREP 1 BL:SWS:REP 24->244|NIRC_SHIFL|3e-35|32.7|217/268| TM:NTM 6 TM:REGION 27->49| TM:REGION 66->88| TM:REGION 103->125| TM:REGION 147->169| TM:REGION 186->208| TM:REGION 229->250| RP:PFM:NREP 1 RP:PFM:REP 18->244|PF01226|2e-34|38.8|227/248|Form_Nir_trans| HM:PFM:NREP 1 HM:PFM:REP 12->248|PF01226|1.1e-63|32.9|237/250|Form_Nir_trans| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF01226|IPR000292| GO:PFM GO:0006810|"GO:transport"|PF01226|IPR000292| GO:PFM GO:0016020|"GO:membrane"|PF01226|IPR000292| OP:NHOMO 641 OP:NHOMOORG 411 OP:PATTERN ----------------1---------------1--1-111111-1211---------112-------- ------1--------11--------1------1111--------11--1------------------------------1-1------------11-------------------------------------------------1------------1-11-1--------1-----1------------1113333333323333331-22-23321---112222222-1-22222222222222211-23--------------------1-1111111111111111111111111-1111111-111111---1111---111111111212-2---221-2--1-1---11--11--11--1--11-------------1------11--1------------11-11111-------------------1---1------2---------------1---------------------------------------1----------------------------------1-------1-1--11--1---------11--2-11-----1--------11-1-1-------11-11-----------------1------222111--2-2-1111-1111111111111--1----------21111223332322233-3332322232323333332111111112222222222222222223322222-322222222222------------------222111111111111----------11----1------1-1-11----------23332222223333--------------------------------1--------------------------------------1- 11------1-----111-211211121-------------------11--2122-----111111111111111111111111111------1-1-------1-----26------------------------------------------------------------------651G11122-------11----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //