[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0105
DDBJ      :CPE0105      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:145 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->30 PF09693 * Phage_XkdX 6.8e-05 40.0 20/40  
:BLT:SWISS 16->75 NUD1_YEAST 7e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79811.1 GT:GENE CPE0105 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 144710..145147 GB:FROM 144710 GB:TO 145147 GB:DIRECTION + GB:GENE CPE0105 GB:PRODUCT hypothetical protein GB:NOTE 145 aa, no significant homology. GB:PROTEIN_ID BAB79811.1 LENGTH 145 SQ:AASEQ MLFYGVISVEYKKEQFNEKVLTNHITKEQWIDILKNSNLIGLRDMKILLNLYGSNGQPLKTSLIGEHLEFGDISARIQKMCKRIEEELGIGLDEKSEMGSWKYKFRHWFIMLNGSKIYDEKEEKNYFTWTLKKELKEAIDSLLGK GT:EXON 1|1-145:0| BL:SWS:NREP 1 BL:SWS:REP 16->75|NUD1_YEAST|7e-04|33.3|60/851| HM:PFM:NREP 1 HM:PFM:REP 11->30|PF09693|6.8e-05|40.0|20/40|Phage_XkdX| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-26,31-32,34-34,39-39,67-67,73-74,76-76,81-81| PSIPRED ccEEEEEEEEEEHHHHHHHHHHHHccHHHHHHHHHcccEEEHHHHHHHHHHHcccccEEHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEEEEccEEcccHHHccEEEEEHHHHHHHHHHHHHcc //