[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0114
DDBJ      :CPE0114      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   7->68 PF11148 * DUF2922 8e-09 51.6 %
:HMM:PFM   6->72 PF11148 * DUF2922 2.5e-25 46.3 67/69  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79820.1 GT:GENE CPE0114 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 154720..154944 GB:FROM 154720 GB:TO 154944 GB:DIRECTION + GB:GENE CPE0114 GB:PRODUCT hypothetical protein GB:NOTE 74 aa, no significant homology. GB:PROTEIN_ID BAB79820.1 LENGTH 74 SQ:AASEQ MEKELYLVLSFKNAGGSITKITLKNIKEDVTEEEVQNLMEKIVTANIFVSKGGDLVSKVKGEIVEKTTESFEMS GT:EXON 1|1-74:0| RP:PFM:NREP 1 RP:PFM:REP 7->68|PF11148|8e-09|51.6|62/69|DUF2922| HM:PFM:NREP 1 HM:PFM:REP 6->72|PF11148|2.5e-25|46.3|67/69|DUF2922| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 69-72| PSIPRED cccEEEEEEEEEcccccEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEEEEccEEEEEEEc //