[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0121
DDBJ      :CPE0121      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->53 PF07698 * 7TM-7TMR_HD 0.001 29.2 48/194  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79827.1 GT:GENE CPE0121 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 161176..161373 GB:FROM 161176 GB:TO 161373 GB:DIRECTION + GB:GENE CPE0121 GB:PRODUCT hypothetical protein GB:NOTE 65 aa, no significant homology. GB:PROTEIN_ID BAB79827.1 LENGTH 65 SQ:AASEQ MGKKFLVVVIVCIFIRCLLNLIEAIMLNIEFLKNINFYYINTFVNAFLVIILIGSYIYLYKNYEK GT:EXON 1|1-65:0| TM:NTM 2 TM:REGION 6->28| TM:REGION 38->59| HM:PFM:NREP 1 HM:PFM:REP 6->53|PF07698|0.001|29.2|48/194|7TM-7TMR_HD| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccc //