[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0127
DDBJ      :CPE0127      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->53 PF10856 * DUF2678 0.00069 27.7 47/118  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79833.1 GT:GENE CPE0127 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 166569..166763 GB:FROM 166569 GB:TO 166763 GB:DIRECTION + GB:GENE CPE0127 GB:PRODUCT hypothetical protein GB:NOTE 64 aa, no significant homology. Putative N-terminal signal sequence and 1 putative transmembrane region were found by PSORT GB:PROTEIN_ID BAB79833.1 LENGTH 64 SQ:AASEQ MKKYLDKLQNMPIGISGTCLAFITLSNSWKLKGINYFKPIAIFLAVCMLSLMILRLIRFPKVIV GT:EXON 1|1-64:0| TM:NTM 1 TM:REGION 38->60| HM:PFM:NREP 1 HM:PFM:REP 6->53|PF10856|0.00069|27.7|47/118|DUF2678| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cHHHHHHHHcccccccccEEEEEEEcccEEEccccHHHHHHHHHHHHHHHHHHHHHHHccHHcc //