[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0128
DDBJ      :CPE0128      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:209 amino acids
:PSIPRED
:HMM:PFM   2->137 PF03595 * C4dic_mal_tran 1.1e-19 24.1 133/287  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79834.1 GT:GENE CPE0128 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 166956..167585 GB:FROM 166956 GB:TO 167585 GB:DIRECTION + GB:GENE CPE0128 GB:PRODUCT conserved hypothetical protein GB:NOTE 209 aa, similar to gpu:AE004302_6 conserved hypothetical protein from Vibrio cholerae (322 aa); 28.8% identity in 240 aa overlap. ATT start. Putative N-terminal signal sequence and 3 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB79834.1 LENGTH 209 SQ:AASEQ MPTCFIVYTGMITGSVASKGMDGVIPQIPQIAHFMLMFGFIFYTILLPLVLYIVFKSEILDDHKLPTVGIICSPAPLGVVGILTIEPNPNPYMLAWLIITGLILLVVVYGYILKLFKEGFKPSYAAFTFPLAIATLSAFKLSTYFTGLGYAKMANLFKFLGDVEIFIATYVIFFMLLNFLNMFFKAISPKLGEYVEEEEELIGGTLYSK GT:EXON 1|1-209:0| TM:NTM 6 TM:REGION 1->23| TM:REGION 34->56| TM:REGION 64->85| TM:REGION 92->114| TM:REGION 118->140| TM:REGION 162->184| SEG 97->115|liitglillvvvygyilkl| SEG 173->184|ffmllnflnmff| SEG 196->200|eeeee| HM:PFM:NREP 1 HM:PFM:REP 2->137|PF03595|1.1e-19|24.1|133/287|C4dic_mal_tran| OP:NHOMO 51 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------------------------------------11--1111111----1---1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------1-----------1111-1-11111111111-----------------1------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccEEEEEEEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHccc //