[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0130
DDBJ      :CPE0130      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:50 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->44 PF10086 * DUF2324 0.00016 35.7 28/223  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79836.1 GT:GENE CPE0130 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 169320..169472 GB:FROM 169320 GB:TO 169472 GB:DIRECTION + GB:GENE CPE0130 GB:PRODUCT hypothetical protein GB:NOTE 50 aa, no significant homology. 1 putative transmembrane region was found by PSORT GB:PROTEIN_ID BAB79836.1 LENGTH 50 SQ:AASEQ MIGEVLSFGYDQCAKLGYAMGFGAMEGLVIYLGLLAIIVLKLFNSKSKAN GT:EXON 1|1-50:0| TM:NTM 1 TM:REGION 19->41| HM:PFM:NREP 1 HM:PFM:REP 15->44|PF10086|0.00016|35.7|28/223|DUF2324| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 46-50| PSIPRED cccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //