[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0133
DDBJ      :CPE0133      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:308 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   121->206 PF02517 * Abi 4.5e-16 31.4 86/99  
:HMM:PFM   188->265 PF09835 * DUF2062 0.00015 14.9 67/154  
:HMM:PFM   37->99 PF07274 * DUF1440 9.2e-05 21.3 61/136  
:BLT:SWISS 153->274 LYRA_STAS1 1e-04 27.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79839.1 GT:GENE CPE0133 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 172988..173914 GB:FROM 172988 GB:TO 173914 GB:DIRECTION + GB:GENE CPE0133 GB:PRODUCT conserved hypothetical protein GB:NOTE 308 aa, similar to pir:S75835 hypothetical protein slr1288 from Synechocystis sp. (strain PCC 6803) (194 aa); 30.2% identity in 126 aa overlap. Putative N-terminal signal sequence and 7 putative transmembrane regions were found by PSORT. GB:PROTEIN_ID BAB79839.1 LENGTH 308 SQ:AASEQ MKPIFKVSLYFLIVLVLSIVGPMFVTPVLYKIGLVPPLVLMVIHIIFFIVPAIIYIIVTKSNYKKVFSFKKPKGKDVFFSILIAALALPIMTFFSYTSSLFYTNDVALVLDQMRVYPLWLMILVVGVTPAITEEITIRGIALSGFEFKSKNVAAIMTGIMFGILHLNAHQFLYATAMGIILAYVVRATGSIFLSMLIHFLINSWNLIQQRIVSQGITTEDLVHSMDSIKNISMELKIGVFLYYLIAAIVAAFLISYLIRKMEKRNFDITLDELDVATRVSYKEERVINVPFIISVIVFIVYTFFIMKG GT:EXON 1|1-308:0| BL:SWS:NREP 1 BL:SWS:REP 153->274|LYRA_STAS1|1e-04|27.4|113/100| TM:NTM 7 TM:REGION 4->26| TM:REGION 35->57| TM:REGION 75->97| TM:REGION 111->133| TM:REGION 180->202| TM:REGION 236->258| TM:REGION 285->307| SEG 42->58|vihiiffivpaiiyiiv| SEG 64->75|kkvfsfkkpkgk| SEG 286->305|vinvpfiisvivfivytffi| HM:PFM:NREP 3 HM:PFM:REP 121->206|PF02517|4.5e-16|31.4|86/99|Abi| HM:PFM:REP 188->265|PF09835|0.00015|14.9|67/154|DUF2062| HM:PFM:REP 37->99|PF07274|9.2e-05|21.3|61/136|DUF1440| OP:NHOMO 24 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211------111111---11111-1--11----------1--111------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccHHHHHHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccEEEEHHHHHHHHHHHHHHHHHHcc //