[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0136
DDBJ      :CPE0136      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.61.1
:181 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   37->132 1vdxA PDBj 2e-07 32.3 %
:RPS:PDB   3->180 2d4gA PDBj 2e-15 17.5 %
:RPS:SCOP  1->126 1iuhA  d.61.1.2 * 1e-14 15.1 %
:HMM:SCOP  1->180 1fsiA_ d.61.1.1 * 3.2e-22 27.8 %
:HMM:PFM   35->78 PF02834 * 2_5_RNA_ligase 5.1e-06 27.3 44/87  
:BLT:SWISS 37->132 Y099_PYRHO 6e-07 32.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79842.1 GT:GENE CPE0136 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(175492..176037) GB:FROM 175492 GB:TO 176037 GB:DIRECTION - GB:GENE CPE0136 GB:PRODUCT hypothetical protein GB:NOTE 181 aa, similar to sp:Y099_PYRHO HYPOTHETICAL PROTEIN PH0099 from Pyrococcus horikoshii (184 aa); 31.3% identity in 96 aa overlap GB:PROTEIN_ID BAB79842.1 LENGTH 181 SQ:AASEQ MLYYLVALFDKVSYAIIKPLQESISNEYKLYENLPMLHITLAVIEDPDMDKLNEVVKNTLKSYKKFEVHLNGLIKFGEPYRSVNLKVDEESGVIKKLSRELYENLSKEGFKLTSNPDTWQLHVSLANPYFAQRVWGEDEFESAYTKLQDYNFDRELLIDEIQFWRPINDESKMVVFSYPLH GT:EXON 1|1-181:0| BL:SWS:NREP 1 BL:SWS:REP 37->132|Y099_PYRHO|6e-07|32.3|93/184| BL:PDB:NREP 1 BL:PDB:REP 37->132|1vdxA|2e-07|32.3|93/184| RP:PDB:NREP 1 RP:PDB:REP 3->180|2d4gA|2e-15|17.5|160/165| HM:PFM:NREP 1 HM:PFM:REP 35->78|PF02834|5.1e-06|27.3|44/87|2_5_RNA_ligase| RP:SCP:NREP 1 RP:SCP:REP 1->126|1iuhA|1e-14|15.1|126/183|d.61.1.2| HM:SCP:REP 1->180|1fsiA_|3.2e-22|27.8|169/183|d.61.1.1|1/1|LigT-like| OP:NHOMO 25 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111--112222-1--------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 95.6 SQ:SECSTR ##EEEEccccHHHHHHHHHHHHHHcGGGGTcc####ccccccccEEccGGGHHHHHHHHHHTcccEEEEEEEEEcTTTccccEEEEEEcccHHHHHHHHHTTHHHHTcGGGccccccccccEEEEEEEEEEcccccHHHHHHHHHHHTcc#ccEEEEEcEEEEEEEcTTccEEEEEEEEc# PSIPRED ccEEEEEEEcHHHHHHHHHHHHHHHHHccHHHcccccEEEHHHHccccHHHHHHHHHHHcccHHEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHccEEEEcccccccEEEEEccccHHHHHHHHccHHHHHHHHHHccccccEEEEEEEEEEEccccEEEEEEEcccc //