[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0144
DDBJ      :CPE0144      conserved hypothetical protein
Swiss-Prot:KPTA_CLOPE   RecName: Full=Probable RNA 2'-phosphotransferase;         EC=2.7.1.-;

Homologs  Archaea  26/68 : Bacteria  81/915 : Eukaryota  109/199 : Viruses  0/175   --->[See Alignment]
d.166.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->180 1wfxA PDBj 1e-22 40.1 %
:RPS:SCOP  7->180 1wfxA  d.166.1.5 * 2e-58 36.5 %
:HMM:SCOP  6->177 1wfxA_ d.166.1.5 * 2.2e-57 47.1 %
:RPS:PFM   3->174 PF01885 * PTS_2-RNA 7e-25 43.6 %
:HMM:PFM   2->170 PF01885 * PTS_2-RNA 5e-57 39.6 169/186  
:BLT:SWISS 1->183 KPTA_CLOPE e-103 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79850.1 GT:GENE CPE0144 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 183767..184318 GB:FROM 183767 GB:TO 184318 GB:DIRECTION + GB:GENE CPE0144 GB:PRODUCT conserved hypothetical protein GB:NOTE 183 aa, similar to sp:YJII_ECOLI HYPOTHETICAL 24.6 KDA PROTEIN IN IADA-MCRD INTERGENIC REGION (O218) from Escherichia coli (218 aa); 43.5% identity in 170 aa overlap GB:PROTEIN_ID BAB79850.1 LENGTH 183 SQ:AASEQ MKNNDSKISKYISLILRHKPEEIGLKLDEHGYLGVLDLIEGLNKSYKGFSMDDLERIVREDSKGRYSFNEDKSKIRANQGHSIKVDLGLEAIKPPKVLYHGTGRKYIESILKNGLIKKERQYVHLSKDIETASIVGKRHGDLVILEVDSESMFKDGIKFYLSKNNVWLCDYVKVEYIKEISLL GT:EXON 1|1-183:0| SW:ID KPTA_CLOPE SW:DE RecName: Full=Probable RNA 2'-phosphotransferase; EC=2.7.1.-; SW:GN Name=kptA; OrderedLocusNames=CPE0144; SW:KW Complete proteome; NAD; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->183|KPTA_CLOPE|e-103|100.0|183/183| GO:SWS:NREP 1 GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 7->180|1wfxA|1e-22|40.1|167/177| RP:PFM:NREP 1 RP:PFM:REP 3->174|PF01885|7e-25|43.6|172/186|PTS_2-RNA| HM:PFM:NREP 1 HM:PFM:REP 2->170|PF01885|5e-57|39.6|169/186|PTS_2-RNA| GO:PFM:NREP 2 GO:PFM GO:0006388|"GO:tRNA splicing, via endonucleolytic cleavage and ligation"|PF01885|IPR002745| GO:PFM GO:0016772|"GO:transferase activity, transferring phosphorus-containing groups"|PF01885|IPR002745| RP:SCP:NREP 1 RP:SCP:REP 7->180|1wfxA|2e-58|36.5|170/180|d.166.1.5| HM:SCP:REP 6->177|1wfxA_|2.2e-57|47.1|170/0|d.166.1.5|1/1|ADP-ribosylation| OP:NHOMO 257 OP:NHOMOORG 216 OP:PATTERN 11-111------------1111121-----------------------111111111111--11---- ----1-------------------------------------------------------1---1---11-----------2-------------------1---11------------------------------11-1---1-1--------------------1-1-------------1-------------------------------1---------------21------------------------11---------11-------------------------------------------1-------------1---------------111--1---1------------------11--1----------------------------------------------111-11-111-------------------------------------------------------------------------1--------------1-----1----------------1------------1-------------------------------------------1-------------------------------------------------------------------------------1---1-1111----111-1-1-1111111----11--------------------11-111------------------------------1-----------------------------111--1--------11------------------------------------------1------------------------------------------------------- --11111-----11-11-1---------------------------11111111111----111111111111111111111111111-11-1111-----1-11--1-12-3111111--11-11-11382-113-1111-111---1-1--21--11252111--1--1--------7-----1112-271---1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 91.3 SQ:SECSTR ######cHHHHHHHHHHTcTGGGTccccTTccEEHHHHHHHHHHT##TcTTccHHHHHHHcccccEEEE##TTEEEEcccccccccccccccccccEEEEcccGGGHHHHHHc##cccccccEEEEccHHHHHHHHTTcccccEEEEEHHHHHHTTcccEEcc#cEEEEccccGGGEEEE### DISOP:02AL 1-3| PSIPRED cccHHHHHHHHHHHHHHccHHHcccEEcccccccHHHHHHHHHHHcccccHHHHHHHHHHcccccEEEEccccEEEEEEccEEEEEEcccccccccEEEEcccHHHHHHHHHHcccccccEEEEEcccHHHHHEEEEEcccEEEEEEcHHHHHHcccEEEEEcccEEEEccccHHHHEEEccc //