[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0160
DDBJ      :CPE0160      conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  66/915 : Eukaryota  54/199 : Viruses  2/175   --->[See Alignment]
d.336.1
:183 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   39->180 2b3wA PDBj 4e-11 31.2 %
:RPS:PDB   38->177 2b3wA PDBj 6e-24 30.2 %
:RPS:SCOP  37->182 2b3wA1  d.336.1.1 * 7e-26 29.5 %
:HMM:SCOP  5->180 2b3wA1 d.336.1.1 * 1.9e-52 45.5 %
:RPS:PFM   40->180 PF08719 * DUF1768 2e-38 54.0 %
:HMM:PFM   28->180 PF08719 * DUF1768 1.6e-59 54.1 146/157  
:BLT:SWISS 19->178 YR617_MIMIV 5e-34 47.8 %
:COIL

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79866.1 GT:GENE CPE0160 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 204516..205067 GB:FROM 204516 GB:TO 205067 GB:DIRECTION + GB:GENE CPE0160 GB:PRODUCT conserved hypothetical protein GB:NOTE 183 aa, similar to pir:T35433 hypothetical protein SC6A9.02 SC6A9.02 from Streptomyces coelicolor (213 aa); 45.2% identity in 177 aa overlap GB:PROTEIN_ID BAB79866.1 LENGTH 183 SQ:AASEQ MRYSVEGVCEKFKSGEKLEFLFFLGHTKNKNGKATKACFSQWYLSDFTVNGVLYNCAEKYMMAEKARLFKDYETLEEILSAENQKEIKDLGRKVKNFNEELWNREKYEIVKRGNLAKFSQNEDIKEFLLSTGDKIIVEASPYDSIWGIGMGAKDENIEDPTAWKGENLLGFALMEVRDLLNAM GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 19->178|YR617_MIMIV|5e-34|47.8|157/170| COIL:NAA 22 COIL:NSEG 1 COIL:REGION 80->101| BL:PDB:NREP 1 BL:PDB:REP 39->180|2b3wA|4e-11|31.2|128/168| RP:PDB:NREP 1 RP:PDB:REP 38->177|2b3wA|6e-24|30.2|126/168| RP:PFM:NREP 1 RP:PFM:REP 40->180|PF08719|2e-38|54.0|139/153|DUF1768| HM:PFM:NREP 1 HM:PFM:REP 28->180|PF08719|1.6e-59|54.1|146/157|DUF1768| RP:SCP:NREP 1 RP:SCP:REP 37->182|2b3wA1|7e-26|29.5|132/160|d.336.1.1| HM:SCP:REP 5->180|2b3wA1|1.9e-52|45.5|156/0|d.336.1.1|1/1|YbiA-like| OP:NHOMO 159 OP:NHOMOORG 122 OP:PATTERN -------------------------------------------------------------------- ----2------------------------------------1------------------11--1--111------------------------------111--1--------------------------------------1-2--1-------------1-1-1121--------------1-------------------------------------------2111----------------------------------------------------------------------------------------------1------111------112-------1-------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1-------1-------1-------------------------------------------------------11---1------------------------------1-------1--------------------------------------------1------11-1-1--1-----2-------------------------11-1111-------------------------------------------------11-1------1111-1-1--------------------------------------------------1------------------------------------------------------- -----31---1---122211-----1-11111111111-1-11----311112123-11------------------------------1--21-4---1--------342---------------------------------------------------222------34---1------------2-2--1-11- -------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 133 STR:RPRED 72.7 SQ:SECSTR #####################################TTcTTccccEEETTEEEccHHHHHHHHHcc#cccHHHHHHHHHcccHHHHHHHHccccccccTTHHHHHHHHHHHHHHHHHHccHHHHHHHHHTTTEEEEEccccccccccT#########cTTTTcccTHHHHHHHHHHHHH### PSIPRED ccHHHHHHHHHHHccccEEEEEEEcccccccccccccHHcccccccEEEccEEEccHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccEEEEccccccEEEEcccccHHHHccccccccccHHHHHHHHHHHHHHHc //