[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0165
DDBJ      :CPE0165      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:55 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->48 PF05190 * MutS_IV 0.00011 38.9 18/92  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79871.1 GT:GENE CPE0165 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 211256..211423 GB:FROM 211256 GB:TO 211423 GB:DIRECTION + GB:GENE CPE0165 GB:PRODUCT hypothetical protein GB:NOTE 55 aa, similar to gp:CLOPBG_3 unknown from Clostridium perfringens (72 aa); 100% identity in 55 aa overlap GB:PROTEIN_ID BAB79871.1 LENGTH 55 SQ:AASEQ MLVAFIKEVINPNLGKKVIIHVSRSRYLFYNLCSNKLHGYYLRITIYNHMTINNK GT:EXON 1|1-55:0| HM:PFM:NREP 1 HM:PFM:REP 31->48|PF05190|0.00011|38.9|18/92|MutS_IV| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 54-55| PSIPRED cHHHHHHHHcccccccEEEEEEEccEEEEEEEcccccccEEEEEEEEEEEEEEcc //