[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0252
DDBJ      :CPE0252      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:148 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->60 PF00558 * Vpu 0.00029 16.1 56/81  
:HMM:PFM   73->107 PF06733 * DEAD_2 0.00093 36.4 33/173  
:BLT:SWISS 6->105 VF145_ASFK5 5e-04 36.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79958.1 GT:GENE CPE0252 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION complement(326287..326733) GB:FROM 326287 GB:TO 326733 GB:DIRECTION - GB:GENE CPE0252 GB:PRODUCT hypothetical protein GB:NOTE 148 aa, similar to N-terminal of sp:DIVB_BACSU DIVISION INITIATION PROTEIN (CELL DIVISION AND SPORULATION PROTEIN) from Bacillus subtilis (263 aa); 25.2% identity in 115 aa overlap. Putative N-terminal signal sequence was found by PSORT GB:PROTEIN_ID BAB79958.1 LENGTH 148 SQ:AASEQ MIFLCIFLILLGVCAVAFVLYQCNIKITEYKRQILTLNNQLSKYKDTTYKKSNNDSKKTLIINFNKPEFRYGITLPYTSIFIAPSEESIAISKIKEKSQVKIIDEAEINNEIWYYSLLNTESKINCNGWIKKSQFSMLMEDTNNIIGE GT:EXON 1|1-148:0| BL:SWS:NREP 1 BL:SWS:REP 6->105|VF145_ASFK5|5e-04|36.8|87/100| TM:NTM 1 TM:REGION 3->25| HM:PFM:NREP 2 HM:PFM:REP 2->60|PF00558|0.00029|16.1|56/81|Vpu| HM:PFM:REP 73->107|PF06733|0.00093|36.4|33/173|DEAD_2| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------11-1-----111-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 49-54, 145-148| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccHHHHHHEEEEEEEHHHHHHHHHHcccccccccEEEEEEEEccEEEccEEEcccEEEEEEccccEEEEEEccccEEEEEEccccccEEEEEEEEEcEEEccccccEEcHHEEEEEHHccccccc //