[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Clostridium perfringens str. 13 (cper0)
Gene : CPE0253
DDBJ      :CPE0253      hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:67 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->63 PF05974 * DUF892 2.9e-05 27.8 54/159  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAB79959.1 GT:GENE CPE0253 GT:PRODUCT hypothetical protein GT:DATABASE GIB00075CH01 GT:ORG cper0 GB:ACCESSION GIB00075CH01 GB:LOCATION 326853..327056 GB:FROM 326853 GB:TO 327056 GB:DIRECTION + GB:GENE CPE0253 GB:PRODUCT hypothetical protein GB:NOTE 67 aa, no significant homology. GB:PROTEIN_ID BAB79959.1 LENGTH 67 SQ:AASEQ MLGGIIMANLNELELQNLRHLIGAHCTIEKKLECYSEQCTDPTLKNMLKKDAQDAKNSKEKLMSFLG GT:EXON 1|1-67:0| HM:PFM:NREP 1 HM:PFM:REP 10->63|PF05974|2.9e-05|27.8|54/159|DUF892| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111------111--------------------------------------------------------------------------------------------------------------111-1--111-----111--1--------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 47-59| PSIPRED ccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcc //